Overview

  • Product name

  • Description

    Rabbit polyclonal to Cdx4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Cdx4 aa 16-174.
    Sequence:

    GTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPH WPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSN LGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQ VTGKTRTKE


    Database link: O14627

  • Positive control

    • WB: RAW 264.7, HeLa and HepG2 whole cell lysates; Mouse liver tissue lysate. IHC-P: Human lung and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 31 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-Cdx4 antibody (ab222909) at 1/500 dilution

    Lane 1 : RAW 264.7 (mouse macrophage cell line transformed with Abelson murine leukemia virus) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lung tissue stained for Cdx4 using ab222909 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for Cdx4 using ab222909 at 1/100 dilution in immunohistochemical analysis.

References

ab222909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up