Overview

  • Product name
  • Description
    Rabbit polyclonal to CEACAM1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human CEACAM1 aa 145-413. The exact sequence is proprietary.
    Sequence:

    PKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLS NGNRTLTLLSVTRNDTGPYECEIQNP VSANRSDPVT LNVTYGPDTP TISPSDTYYR PGANLSLSCY AASNPPAQYS WLINGTFQQS TQELFIPNIT VNNSGSYTCH ANNSVTGCNR TTVKTIIVTE LSPVVAKPQI KASKTTVTGD KDSVNLTCST NDTGISIRWF FKNQSLPSSE RMKLSQGNTT LSINPVKRED AGTYWCEVFN PISKNQSDPIMLN


    Database link: P13688

  • Positive control
    • Human liver cancer and bladder carcinoma tissue lysates; Human lung cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol

    PBS without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/15 - 1/50.
WB 1/500 - 1/2000. Predicted molecular weight: 57 kDa.

Target

  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted; Cell membrane and Cell membrane. Localizes to sites of cell-cell contact.
  • Information by UniProt
  • Database links
  • Form
    There are 11 isoforms produced by alternative splicing. Isoform 1 = BGPa; CEACAM1-4L; TM1-CEA; Isoform 2 = BGPg; CEACAM1-4C1; Isoform 3 = BGPh; CEACAM1-3; Isoform 4 = BGPi; CEACAM1-3C2; Isoform 5 = BGPy; CEACAM1-3AL; Isoform 6 = BGPb; CEACAM1-3L; TM2-CEA; Isoform 7 = BGPx; CEACAM1-1L; Isoform 8 = BGPc; CEACAM1-4S; TM3-CEA; Isoform 9 = BGPz; CEACAM1-3AS and Isoform 11 = BGPd; CEACAM1-3S.
  • Alternative names
    • Antigen CD66 antibody
    • BGP 1 antibody
    • BGP antibody
    • BGP-1 antibody
    • BGPI antibody
    • Biliary glycoprotein 1 antibody
    • Biliary glycoprotein adhesion molecule antibody
    • Biliary glycoprotein antibody
    • Carcinoembryonic antigen related cell adhesion molecule 1 antibody
    • carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) antibody
    • Carcinoembryonic antigen-related cell adhesion molecule 1 antibody
    • CD66a antibody
    • CD66a antigen antibody
    • CEACAM1 antibody
    • CEAM1_HUMAN antibody
    • meconium antigen 100 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human lung cancer tissue labeling CEACAM1 with ab182622 at 1/25 dilution  (left). The image on the right has been treated with the immunogen.

  • All lanes : Anti-CEACAM1 antibody (ab182622) at 1/400 dilution

    Lane 1 : Human liver cancer tissue lysate
    Lane 2 : Human bladder carcinoma tissue lysate

    Lysates/proteins at 60 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L HRP conjugated antibody at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 2 minutes


    Gel: 10%SDS-PAGE

References

ab182622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up