Overview

  • Product name

  • Description

    Rabbit polyclonal to CEAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CEAP aa 44-142.
    Sequence:

    MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKD LNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR


    Database link: Q6QNY1

  • Positive control

    • IHC-P: Human gastric cancer and brain tissues.
  • General notes

     This product was previously labelled as BLOC1S2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human brain tissue stained for CEAP using ab234763 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for CEAP using ab234763 at 1/100 dilution in immunohistochemical analysis.

References

ab234763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up