Anti-CEBPE antibody (ab246861)
Key features and details
- Rabbit polyclonal to CEBPE
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CEBPE antibody
See all CEBPE primary antibodies -
Description
Rabbit polyclonal to CEBPE -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep -
Immunogen
Recombinant fragment corresponding to Human CEBPE aa 2-125.
Sequence:SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEE QLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKA LGPGIYSSPGSYDPRAVAVKEEPR
Database link: Q15744 -
Positive control
- WB: CEBPE with C-terminal myc-DDK tag overexpressed in HEK-293T, whole cell lysate. IHC-P: Human bone marrow tissue. ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246861 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 31 kDa. |
Target
-
Function
C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. -
Tissue specificity
Strongest expression occurs in promyelocyte and late-myeloblast-like cell lines. -
Sequence similarities
Belongs to the bZIP family. C/EBP subfamily.
Contains 1 bZIP domain. -
Post-translational
modificationsPhosphorylated. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1053 Human
- Entrez Gene: 110794 Mouse
- Entrez Gene: 25410 Rat
- Omim: 600749 Human
- SwissProt: Q15744 Human
- SwissProt: Q6PZD9 Mouse
- SwissProt: P56261 Rat
- Unigene: 558308 Human
see all -
Alternative names
- C/EBP epsilon antibody
- CCAAT/enhancer binding protein (C/EBP) epsilon antibody
- CCAAT/enhancer binding protein epsilon antibody
see all
Images
-
All lanes : Anti-CEBPE antibody (ab246861) at 0.4 µg
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : CEBPE with C-terminal myc-DDK tag overexpressed in HEK-293T, whole cell lysate.
Predicted band size: 31 kDa -
PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CEBPE (green) using ab246861 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CEBPE antibody (ab246861)Paraffin-embedded human bone marrow tissue stained for CEBPE using ab246861 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CEBPE antibody (ab246861)
Paraffin-embedded human cerebral cortex tissue stained for CEBPE using ab246861 at 1/50 dilution in immunohistochemical analysis. Low expression, as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246861 has not yet been referenced specifically in any publications.