Anti-CEBPE antibody (ab246861)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CEBPE antibody
See all CEBPE primary antibodies -
Description
Rabbit polyclonal to CEBPE -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep
-
Immunogen
Recombinant fragment corresponding to Human CEBPE aa 2-125.
Sequence:SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEE QLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKA LGPGIYSSPGSYDPRAVAVKEEPR
Database link: Q15744 -
Positive control
- WB: CEBPE with C-terminal myc-DDK tag overexpressed in HEK-293T, whole cell lysate. IHC-P: Human bone marrow tissue. ICC/IF: U-251 MG cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246861 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 31 kDa. |
Target
-
Function
C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. -
Tissue specificity
Strongest expression occurs in promyelocyte and late-myeloblast-like cell lines. -
Sequence similarities
Belongs to the bZIP family. C/EBP subfamily.
Contains 1 bZIP domain. -
Post-translational
modificationsPhosphorylated. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1053 Human
- Entrez Gene: 110794 Mouse
- Entrez Gene: 25410 Rat
- Omim: 600749 Human
- SwissProt: Q15744 Human
- SwissProt: Q6PZD9 Mouse
- SwissProt: P56261 Rat
- Unigene: 558308 Human
see all -
Alternative names
- C/EBP epsilon antibody
- CCAAT/enhancer binding protein (C/EBP) epsilon antibody
- CCAAT/enhancer binding protein epsilon antibody
see all
Images
-
Western blot - Anti-CEBPE antibody (ab246861)All lanes : Anti-CEBPE antibody (ab246861) at 0.4 µg
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : CEBPE with C-terminal myc-DDK tag overexpressed in HEK-293T, whole cell lysate.
Predicted band size: 31 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-CEBPE antibody (ab246861)PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CEBPE (green) using ab246861 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CEBPE antibody (ab246861)Paraffin-embedded human bone marrow tissue stained for CEBPE using ab246861 at 1/50 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CEBPE antibody (ab246861)Paraffin-embedded human cerebral cortex tissue stained for CEBPE using ab246861 at 1/50 dilution in immunohistochemical analysis. Low expression, as expected.
Datasheets and documents
References
ab246861 has not yet been referenced specifically in any publications.
