Overview

  • Product name

  • Description

    Rabbit polyclonal to CECR5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CECR5 aa 250-300 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    FGHGTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERR G


    Database link: Q9BXW7

  • Positive control

    • Rat brain and Mouse lung tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 46 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Mouse lung tissue labeling CECR5 with ab204115 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling CECR5 with ab204115 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

References

ab204115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up