Overview

  • Product name

    Cecropin B, antibacterial peptide
  • Description

    Antibacterial peptide
  • Biological description

    Antibacterial peptide. Lyse bacterial cell membranes, inhibit proline uptake and cause leaky membranes. Have a broad spectrum of activity.
  • Purity

    > 95%
  • CAS Number

    80451-05-4
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    3834.76
  • Molecular formula

    C176H302N52O41S
  • Sequence

    KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL (Modifications: C-terminal amide)
  • PubChem identifier

    16130488
  • Storage instructions

    Store at +4°C. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • SMILES

    CCC(C)C(C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NCC(=O)N1CCCC1C(=O)NC(C)C(=O)NC(C(C)CC)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCC(=O)O)C(=O)NC(C)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)N)NC(=O)CNC(=O)C(CC(=O)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)CC)NC(=O)C(CC(=O)N)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(CCC(=O)O)NC(=O)C(C(C)CC)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CCCCN)NC(=O)C(CC3=CNC4=CC=CC=C43)NC(=O)C(CCCCN)N
  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Luo CC  et al. Goat mammary gland expression of Cecropin B to inhibit bacterial pathogens causing mastitis. Anim Biotechnol 24:66-78 (2013). Read more (PubMed: 23394371) »
  • Hu H  et al. Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol Cells 35:106-14 (2013). Read more (PubMed: 23456332) »
  • Liu Z  et al. Crystallization and preliminary X-ray analysis of cecropin B from Bombyx mori. Acta Crystallogr Sect F Struct Biol Cryst Commun 66:851-3 (2010). Read more (PubMed: 20606290) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab143372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up