Anti-Cell division protein ZapA antibody (ab225689)

Overview

  • Product name

    Anti-Cell division protein ZapA antibody
  • Description

    Rabbit polyclonal to Cell division protein ZapA
  • Host species

    Rabbit
  • Specificity

    Predicted to react with Bacillus pumilus (100% sequence identity).
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Bacillus Cell division protein ZapA aa 1-85. Bacillus pumilus.
    Sequence:

    MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYL DINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE


    Database link: A8FG14

  • Positive control

    • WB: Recombinant Bacillus pumilus Cell division protein ZapA protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 26 kDa (predicted molecular weight: 26 kDa).

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Images

  • All lanes : Anti-Cell division protein ZapA antibody (ab225689) at 1/500 dilution

    Lane 1 : Recombinant Bacillus pumilus Cell division protein ZapA protein, 80 ng
    Lane 2 : Recombinant Bacillus pumilus Cell division protein ZapA protein, 40 ng
    Lane 3 : Recombinant Bacillus pumilus Cell division protein ZapA protein, 20 ng
    Lane 4 : Recombinant Bacillus pumilus Cell division protein ZapA protein, 10 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 26 kDa
    Observed band size: 26 kDa



    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab225689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up