Anti-Cellular Apoptosis Susceptibility/CSE1L antibody - N-terminal (ab189180)

Overview

  • Product name

    Anti-Cellular Apoptosis Susceptibility/CSE1L antibody - N-terminal
    See all Cellular Apoptosis Susceptibility/CSE1L primary antibodies
  • Description

    Rabbit polyclonal to Cellular Apoptosis Susceptibility/CSE1L - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, IP, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Cellular Apoptosis Susceptibility/CSE1L aa 1-50. The exact sequence is proprietary. (NP_001307.2).
    Sequence:

    MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLL


    Database link: P55060

  • Positive control

    • Human testis tissue; HeLa cells; 293 cell extracts.
  • General notes

     This product was previously labelled as Cellular Apoptosis Susceptibility

     

Properties

Applications

Our Abpromise guarantee covers the use of ab189180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 110 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
IP Use at an assay dependent concentration.
ICC/IF 1/100 - 1/500.

Target

  • Function

    Export receptor for importin-alpha. Mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates (cargos) have been released into the nucleoplasm. In the nucleus binds cooperatively to importin-alpha and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the importin-alpha from the export receptor. CSE1L/XPO2 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
  • Tissue specificity

    Highly expressed in proliferating cells.
  • Sequence similarities

    Belongs to the XPO2/CSE1 family.
    Contains 1 importin N-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAS antibody
    • Cellular apoptosis susceptibility protein antibody
    • Chromosome segregation 1 (yeast homolog) like antibody
    • Chromosome segregation 1 Like antibody
    • Chromosome segregation 1 like protein antibody
    • Chromosome segregation 1-like protein antibody
    • Chromosome segregation gene CSE1 antibody
    • CSE 1 antibody
    • CSE 1 chromosome segregation 1 like antibody
    • CSE 1 chromosome segregation 1 like protein antibody
    • CSE 1L antibody
    • CSE1 antibody
    • CSE1 chromosome segregation 1 like (yeast) antibody
    • CSE1 chromosome segregation 1 like antibody
    • CSE1 chromosome segregation 1 like protein antibody
    • CSE1L antibody
    • Exp 2 antibody
    • Exp2 antibody
    • Exportin 2 antibody
    • Exportin-2 antibody
    • Exportin2 antibody
    • Importin alpha re exporter antibody
    • Importin-alpha re-exporter antibody
    • MGC117283 antibody
    • MGC130036 antibody
    • MGC130037 antibody
    • XPO 2 antibody
    • XPO2 antibody
    • XPO2_HUMAN antibody
    see all

Images

  • All lanes : Anti-Cellular Apoptosis Susceptibility/CSE1L antibody - N-terminal (ab189180) at 1/500 dilution

    Lane 1 : 293 cell extract
    Lane 2 : 293 cell extract with immunizing peptide

    Predicted band size: 110 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling Cellular Apoptosis Susceptibility/CSE1L with ab189180 at 10 µg/ml.

  • Immunofluorescent analysis of HeLa cells labeling Exportin 2 with ab189180 at 1/100 dilution in the presence (right panel) or absence (left panel) of immunizing peptide.

References

ab189180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up