Overview

  • Product name
    Anti-CENPC antibody [2159C5a]
    See all CENPC primary antibodies
  • Description
    Mouse monoclonal [2159C5a] to CENPC
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, Dot blot, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CENPC aa 655-768.
    Sequence:

    KPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDE EVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGE RIDYQGRPSGGFVI


    Database link: Q03188

Properties

Applications

Our Abpromise guarantee covers the use of ab50974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 107 kDa.
Dot blot Use at an assay dependent concentration.
ICC/IF 1/250.

Use at a dilution of 1/250 (for overnight incubation).

Target

  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPC recruits DNA methylation and DNMT3B to both centromeric and pericentromeric satellite repeats and regulates the histone code in these regions.
  • Sequence similarities
    Belongs to the CENPC family.
  • Domain
    The MIF2 homology domain II targets centromeres and binds the alpha satellite DNA in vivo. The MIF2 homology domain III can induce CENPC dimerization/oligomerization.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres.
  • Information by UniProt
  • Database links
  • Alternative names
    • CENP-C 1 antibody
    • CENP-C antibody
    • CENPC_HUMAN antibody
    • CENPC1 antibody
    • Centromere autoantigen C antibody
    • Centromere autoantigen C1 antibody
    • Centromere protein C 1 antibody
    • Centromere protein C antibody
    • hcp-4 antibody
    • ICEN7 antibody
    • Interphase centromere complex protein 7 antibody
    • MIF2 antibody
    see all

Images

  • ab36406 staining human lymphoblastoid cells by ICC/IF.  Cells were PFA fixed and blocked with 1xPBS+1%BSA+0.5%Triton X-100 for 30 minutes at 25°C, prior to incubating with ab36406, diluted 1/250 for 24 hours at 4°C.  An Alexa Fluor® 488 conjugated donkey anti-mouse antibody was used as the secondary.

    See Abreview

References

This product has been referenced in:
  • Platani M  et al. Seh1 targets GATOR2 and Nup153 to mitotic chromosomes. J Cell Sci 131:N/A (2018). Read more (PubMed: 29618633) »
  • Morozov VM  et al. CENP-B protects centromere chromatin integrity by facilitating histone deposition via the H3.3-specific chaperone Daxx. Epigenetics Chromatin 10:63 (2017). Read more (PubMed: 29273057) »
See all 11 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Pig Cell (LLCPK1 pig kidney epithelial cells)
Permeabilization
No
Specification
LLCPK1 pig kidney epithelial cells
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Oct 17 2016

Answer

Thank you for contacting Abcam regarding ab50974.

The immunogen sequence is as follows: XXX Please contact us for additional details.

I hope this information is helpful. Please do not hesitate to contact me if you have any additional questions.

Read More

Answer

I have forwarded the query to our reference team who are going to look into this matter and make any changes to the datasheet that are necessary.

Once again, I apologize for the problems you were having with this antibody.

Please let me know if there is anything else I can help you with.

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (human lymphoblastoid)
Specification
human lymphoblastoid
Fixative
Paraformaldehyde
Blocking step
1XPBS+1%BSA+0.5%TritonX-100 as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 25°C

Dr. Beth Sullivan

Verified customer

Submitted May 21 2008

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up