Overview

  • Product name

  • Description

    Rabbit polyclonal to CENPH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CENPH aa 1-247.
    Sequence:

    MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQT KQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKK LALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDL EEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQ NLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM


    Database link: Q9H3R5

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
  • Sequence similarities

    Belongs to the centromere protein H family.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Associates with active centromere-kinetochore complexes throughout the cell cycle. Colocalizes with inner kinetochore plate proteins CENPA and CENPC1 during both interphase and metaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • CENP H antibody
    • CENP-H antibody
    • CENPH antibody
    • CENPH_HUMAN antibody
    • Centromere protein H antibody
    • ICEN35 antibody
    • Interphase centromere complex protein 35 antibody
    • Kinetochore protein CENP H antibody
    • NNF1 antibody
    • NNF1, MIND kinetochore complex component, homolog antibody
    • PMF1 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for CENPH using ab230202 at 1/100 dilution in immunohistochemical analysis.

References

ab230202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up