Overview

  • Product name

  • Description

    Rabbit polyclonal to CENPJ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human CENPJ aa 720-846.
    Sequence:

    DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESI MESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTY GTPQTCYPNNEIGILDKTIKRKIAPVK


    Database link: Q9HC77

  • Positive control

    • BJ cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Plays an important role in cell division and centrosome function by participating in centriole duplication. Inhibits microtubule nucleation from the centrosome.
  • Involvement in disease

    Defects in CENPJ are the cause of microcephaly primary type 6 (MCPH6) [MIM:608393]. A disorder defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits.
    Defects in CENPJ are the cause of Seckel syndrome type 4 (SCKL4) [MIM:613676]. SCKL4 is a rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.
  • Sequence similarities

    Belongs to the TCP10 family.
  • Post-translational
    modifications

    Phosphorylation at Ser-589 and Ser-595 by PLK2 is required for procentriole formation and centriole elongation. Phosphorylation by PLK2 oscillates during the cell cycle: it increases at G1/S transition and decreases during the exit from mitosis. Phosphorylation at Ser-595 is also mediated by PLK4 but is not a critical step in PLK4 function in procentriole assembly.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > centrosome > centriole. Localized within the center of microtubule asters. During centriole biogenesis, it is concentrated within the proximal lumen of both parental centrioles and procentrioles.
  • Information by UniProt
  • Database links

  • Alternative names

    • BM032 antibody
    • CENP-J antibody
    • CENPJ antibody
    • CENPJ_HUMAN antibody
    • Centromere protein J antibody
    • Centrosomal P4.1-associated protein antibody
    • CPAP antibody
    • LAG-3-associated protein antibody
    • LAP antibody
    • LIP1 antibody
    • LYST interacting protein LIP1 antibody
    • LYST interacting protein LIP7 antibody
    • LYST-interacting protein 1 antibody
    • MCPH6 antibody
    • Sas 4 antibody
    • SASS4 antibody
    • SCKL4 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized BJ cells labeling CENPJ with ab221134 at 4 µg/ml (green).

References

This product has been referenced in:

  • Kovacs L  et al. Gorab is a Golgi protein required for structure and duplication of Drosophila centrioles. Nat Genet 50:1021-1031 (2018). Read more (PubMed: 29892014) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up