Overview

  • Product name

  • Description

    Rabbit polyclonal to CENPP
  • Host species

    Rabbit
  • Specificity

    ab198179 detects endogenous level of total CENPP protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human CENPP aa 1-288. Full length fusion protein. NCBI Accession No. BC071726. The identity of the protein fusion partner is GST.
    Sequence:

    MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGW KSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRK VLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSEL SEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEG PSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD KNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN


    Database link: Q6IPU0

  • Positive control

    • 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab198179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 33 kDa.

Target

  • Function

    Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
  • Cellular localization

    Nucleus. Chromosome > centromere. Localizes exclusively in the centromeres. The CENPA-CAD complex is probably recruited on centromeres by the CENPA-NAC complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • CENP P antibody
    • CENP-P antibody
    • cenpp antibody
    • CENPP_HUMAN antibody
    • Centromere protein P antibody
    • FLJ33928 antibody
    • RP11-19J3.3 antibody
    see all

Images

  • Anti-CENPP antibody (ab198179) at 1/449 dilution + 293T cell lysate at 40 µg

    Predicted band size: 33 kDa



    6%SDS-PAGE

References

ab198179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up