Anti-CENPT antibody (ab220280)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CENPT antibody
See all CENPT primary antibodies -
Description
Rabbit polyclonal to CENPT -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey
-
Immunogen
Recombinant fragment corresponding to Human CENPT aa 60-166.
Sequence:RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVV KPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRL SVFQQGV
Database link: Q96BT3 -
Positive control
- U-251 MG cell lysate; Human plasma; Human liver and Human tonsil tissue lysates; U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220280 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | 1/100 - 1/250. Predicted molecular weight: 60 kDa. |
Target
-
Function
Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENP-T is one of the basic inner kinetochore proteins with most further proteins binding downstream, suggesting a fundamental role of CENP-T in kinetochore function. -
Sequence similarities
Belongs to the CENPT family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres. - Information by UniProt
-
Database links
- Entrez Gene: 80152 Human
- Omim: 611510 Human
- SwissProt: Q4R5U8 Cynomolgus monkey
- SwissProt: Q96BT3 Human
- Unigene: 288382 Human
-
Alternative names
- C16orf56 antibody
- CENP T antibody
- CENP-T antibody
see all
Images
-
Western blot - Anti-CENPT antibody (ab220280)All lanes : Anti-CENPT antibody (ab220280) at 1/100 dilution
Lane 1 : RT-4 cell line lysate
Lane 2 : U-251 MG cell line lysate
Lane 3 : Human plasma
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 60 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-CENPT antibody (ab220280)Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized U-2 OS cells labeling CENPT with ab220280 at 4 μg/mL (green).
-
Immunocytochemistry/ Immunofluorescence - Anti-CENPT antibody (ab220280)This image is courtesy of an abreview by Kirk Mcmanusab14404 staining CENPT in the HeLa cell line by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with paraformaldahyde, permeabilized with 0.5% Triton X-100 in PBS. Samples were incubated with primary antibody (1/500 in PBS) for 1 hour at 21°C. ab150081 (1/200) used as the secondary antibody.
Datasheets and documents
References
ab220280 has not yet been referenced specifically in any publications.
