Anti-CENPT antibody (ab220280)
Key features and details
- Rabbit polyclonal to CENPT
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CENPT antibody
See all CENPT primary antibodies -
Description
Rabbit polyclonal to CENPT -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human CENPT aa 60-166.
Sequence:RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVV KPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRL SVFQQGV
Database link: Q96BT3 -
Positive control
- ICC: U-2 OS whole cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220280 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENP-T is one of the basic inner kinetochore proteins with most further proteins binding downstream, suggesting a fundamental role of CENP-T in kinetochore function. -
Sequence similarities
Belongs to the CENPT family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Chromosome > centromere > kinetochore. Localizes exclusively in the kinetochore domain of centromeres. - Information by UniProt
-
Database links
- Entrez Gene: 80152 Human
- Omim: 611510 Human
- SwissProt: Q4R5U8 Cynomolgus monkey
- SwissProt: Q96BT3 Human
- Unigene: 288382 Human
-
Alternative names
- C16orf56 antibody
- CENP T antibody
- CENP-T antibody
see all
Images
-
Immunocytochemical analysis of U-2 OS (Human bone osteosarcoma epithelial cell line) whole cells labeling CENPT (green) in the nuclear bodies with ab220280 at 2 μg/mL.
-
Immunocytochemistry/ Immunofluorescence - Anti-CENPT antibody (ab220280)This image is courtesy of an abreview by Kirk Mcmanus
ab14404 staining CENPT in the HeLa cell line by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with paraformaldahyde, permeabilized with 0.5% Triton X-100 in PBS. Samples were incubated with primary antibody (1/500 in PBS) for 1 hour at 21°C. ab150081 (1/200) used as the secondary antibody.
Protocols
Datasheets and documents
References (0)
ab220280 has not yet been referenced specifically in any publications.