Overview

  • Product name

  • Description

    Rabbit polyclonal to Centrin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Centrin 1 aa 2-148. Crossreacts with Centrin 2.
    Sequence:

    ASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVK ELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKD TKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDE


    Database link: Q12798

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a fundamental role in microtubule-organizing center structure and function.
  • Sequence similarities

    Belongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Centrosome of interphase and mitotic cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caltractin antibody
    • Caltractin isoform 2 antibody
    • CEN 1 antibody
    • CEN1 antibody
    • Centrin EF hand protein 1 antibody
    • Centrin-1 antibody
    • Centrin1 antibody
    • CETN 1 antibody
    • CETN antibody
    • CETN1 antibody
    • CETN1_HUMAN antibody
    • EF hand protein 1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for Centrin 1 using ab224764 at 1/200 dilution in immunohistochemical analysis.

References

ab224764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up