Overview

  • Product name

  • Description

    Rabbit polyclonal to Centrin 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Centrin 3 aa 1-167.
    Sequence:

    MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHEL KVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH EEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDG DGEINQEEFIAIMTGDI


    Database link: O15182

  • Positive control

    • WB: Mouse gonadal tissue lysate. IHC-P: Human ovarian cancer and testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 20 kDa (predicted molecular weight: 20 kDa).

Target

  • Function

    Plays a fundamental role in microtubule-organizing center structure and function.
  • Sequence similarities

    Belongs to the centrin family.
    Contains 4 EF-hand domains.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Centrosome of interphase and mitotic cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDC31 homolog antibody
    • CEN 3 antibody
    • CEN3 antibody
    • Centrin EF hand protein 3 antibody
    • Centrin-3 antibody
    • Centrin3 antibody
    • CETN 3 antibody
    • Cetn3 antibody
    • CETN3_HUMAN antibody
    • EF hand superfamily member antibody
    • MGC12502 antibody
    • MGC138245 antibody
    see all

Images

  • Anti-Centrin 3 antibody (ab230172) at 1/1000 dilution + Mouse gonadal tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 20 kDa
    Observed band size: 20 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for Centrin 3 with ab230172 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for Centrin 3 with ab230172 at 1/100 dilution in immunohistochemical analysis.

References

ab230172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up