Overview

  • Product name

  • Description

    Rabbit polyclonal to CEP128
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP128 aa 946-1088.
    Sequence:

    EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLEDFKDFRDSCSSSERT DGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQ DHSRFLSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPK


    Database link: Q6ZU80

  • Positive control

    • IHC: Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm > cytoskeleton > spindle pole. Associates with the mother centriole.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf145 antibody
    • C14orf61 antibody
    • CE128_HUMAN antibody
    • Centrosomal protein 128kDa antibody
    • Centrosomal protein of 128 kDa antibody
    • Cep128 antibody
    • LEDP/132 antibody
    • lens epithelium-derived protein antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for CEP128 using ab224041 at 1/200 dilution in immunohistochemical analysis.

References

ab224041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up