Overview

  • Product name

  • Description

    Rabbit polyclonal to CEP152
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Immunogen

    Recombinant fragment corresponding to Human CEP152 aa 498-601.
    Sequence:

    EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLK AEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKT DTSE


    Database link: O94986

  • Positive control

    • IHC-P: Human cerebellum tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Involvement in disease

    Defects in CEP152 are the cause of microcephaly primary type 4 (MCPH4) [MIM:604321]. A disease defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Affected individuals are mentally retarded. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits due to degenerative brain disorder.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt
  • Alternative names

    • Asterless antibody
    • CE152_HUMAN antibody
    • Centrosomal protein 152kDa antibody
    • Centrosomal protein of 152 kDa antibody
    • Cep152 antibody
    • FLJ21594 antibody
    • KIAA0912 antibody
    • MCPH4 antibody
    • MCPH9 antibody
    • Microcephaly primary autosomal recessive 4 antibody
    • SCKL5 antibody
    see all

Images

  • Paraffin-embedded human cerebellum tissue stained for CEP152 using ab223696 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CEP152 (green) using ab223696 at 4 µg/ml in ICC/IF.

References

ab223696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up