Overview

  • Product name

  • Description

    Rabbit polyclonal to CEP350
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP350 aa 1415-1509.
    Sequence:

    QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHIS DAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ


    Database link: Q5VT06

  • Positive control

    • U-251 MG cells.
  • General notes

     This product was previously labelled as CAP350

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Relevance

    CAP350, centrosome associated protein 350, is required for anchoring microtubules to the centrosomes and for the integrity of the microtubule network. It recruits PPARA to discrete subcellular compartments and thereby modulates PPARA activity.
  • Cellular localization

    Centrosome. Spindle. Nucleus. Note=Associated with mitotic spindles. Nuclear, in discrete foci. Associated with intermediate filaments.
  • Database links

  • Alternative names

    • CAP 350 antibody
    • Centrosomal protein 350kDa antibody
    • Centrosome associated protein 350 antibody
    • Centrosome associated protein of 350 kDa antibody
    • CEP 150 antibody
    • CEP 350 antibody
    • CEP350 antibody
    • FLJ38282 antibody
    • FLJ44058 antibody
    • GM133 antibody
    • KIAA0480 antibody
    • RP11 502H18.1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized U-251 MG cells labeling CEP350 with ab220093 at 4 µg/ml (green).

References

ab220093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up