Overview

  • Product name

    Anti-CEP350 antibody [CL3423]
    See all CEP350 primary antibodies
  • Description

    Mouse monoclonal [CL3423] to CEP350
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP350 aa 1415-1509.
    Sequence:

    QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHIS DAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ


    Database link: Q5VT06

  • Epitope

    Binds to an epitope located within the peptide sequence LPDFVKQLRTRT as determined by overlapping synthetic peptides.
  • Positive control

    • Human breast cancer, placenta and colon tissues; U251, A431 and U2OS cells.
  • General notes

     This product was previously labelled as CAP350

     

Properties

Applications

Our Abpromise guarantee covers the use of ab219831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    CAP350, centrosome associated protein 350, is required for anchoring microtubules to the centrosomes and for the integrity of the microtubule network. It recruits PPARA to discrete subcellular compartments and thereby modulates PPARA activity.
  • Cellular localization

    Centrosome. Spindle. Nucleus. Note=Associated with mitotic spindles. Nuclear, in discrete foci. Associated with intermediate filaments.
  • Database links

  • Alternative names

    • CAP 350 antibody
    • Centrosomal protein 350kDa antibody
    • Centrosome associated protein 350 antibody
    • Centrosome associated protein of 350 kDa antibody
    • CEP 150 antibody
    • CEP 350 antibody
    • CEP350 antibody
    • FLJ38282 antibody
    • FLJ44058 antibody
    • GM133 antibody
    • KIAA0480 antibody
    • RP11 502H18.1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U251 cells labeling CEP350 with ab219831 at 4 μg/ml (green). Microtubule and nuclear probes are visualized in red and blue, respectively.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U2OS cells labeling CEP350 with ab219831 at 4 μg/ml (green). Microtubule and nuclear probes are visualized in red and blue, respectively.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling CEP350 with ab219831 at 4 μg/ml (green). Microtubule and nuclear probes are visualized in red and blue, respectively.

     

  • Immunohistochemical analysis of paraffin-embedded human placenta tissue labeling CEP350 with ab219831 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human breast cancer tissue labeling CEP350 with ab219831 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CEP350 with ab219831 at 1/50 dilution.

References

This product has been referenced in:

  • Douanne T  et al. CYLD Regulates Centriolar Satellites Proteostasis by Counteracting the E3 Ligase MIB1. Cell Rep 27:1657-1665.e4 (2019). Read more (PubMed: 31067453) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up