Overview

  • Product name

  • Description

    Rabbit polyclonal to CEP72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP72 aa 200-460.
    Sequence:

    LIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQLVQYQCGDSG KQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTP HPDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQE GLGCPERTHGSSVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTD TREPSPGSHSALPGKKTALQAALLETLLDLVDRSWGGCRSLHSNEAFLAQ ARHILSSVEEF


    Database link: Q9P209-1

  • Positive control

    • IHC-P: Human testis tissue and human cervical cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the recruitment of key centrosomal proteins to the centrosome. Provides centrosomal microtubule-nucleation activity on the gamma-tubulin ring complexes (gamma-TuRCs) and has critical roles in forming a focused bipolar spindle, which is needed for proper tension generation between sister chromatids. Required for localization of KIZ/PLK1S1, AKAP9 and gamma-tubulin ring complexes (gamma-TuRCs).
  • Sequence similarities

    Belongs to the CEP72 family.
    Contains 3 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Localizes to the centrosome and centrosome-surrounding particles throughout the cell cycle. These particles disappear after microtubules are depolymerized using nocodazole, suggesting that CEP72-associating particles localize in a microtubule-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • Centrosomal protein 72kDa antibody
    • Centrosomal protein of 72 kDa antibody
    • Cep72 antibody
    • CEP72_HUMAN antibody
    • FLJ10565 antibody
    • MGC5307 antibody
    • RGD1566336 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for CEP72 using ab230407 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cervical cancer tissue stained for CEP72 using ab230407 at 1/100 dilution in immunohistochemical analysis.

References

ab230407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up