Overview

  • Product name

  • Description

    Rabbit polyclonal to CEP89
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP89 aa 695-775.
    Sequence:

    QVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTG VQDNPRALVAPSLNGVSQADLLDGCDVCSYD


    Database link: Q96ST8

  • Positive control

    • Human lateral ventricle tissue, A431 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle pole. Localizes to structures around centrosomes similar to centrosome satellites.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCDC123 antibody
    • Centrosomal protein 89 kDa antibody
    • Centrosomal protein of 89 kDa antibody
    • cep89 antibody
    • CEP89_HUMAN antibody
    • Coiled-coil domain-containing protein 123 antibody
    • Coiled-coil domain-containing protein 123, mitochondrial antibody
    • FLJ14640 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human lateral ventricle tissue labeling CEP89 with ab204410 at 1/500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling CEP89 with ab204410 at 4 µg/mL (green).

References

ab204410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up