Overview

  • Product name

    Anti-CEP95 antibody
  • Description

    Rabbit polyclonal to CEP95
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CEP95 aa 582-821.
    Sequence:

    TLSKMWKQQIAQVEQLKKECRENRSKKKLQDEIEEALRRHDLLTTLVKKE YEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMM RMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM ENYYKDQFSLLAEAISQEHQELKAREKSQAQTLHKVKRELRSKMEKEIQQ LQDMITQNDDDVFFRELEAERFRSRLQLASFQYSKSPSL


    Database link: Q96GE4

  • Positive control

    • WB: Mouse heart tissue lysate. IHC-P: Human bladder and colon cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 95 kDa (predicted molecular weight: 95, 77 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-CEP95 antibody (ab230305) at 1/1000 dilution + Mouse heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 95, 77 kDa
    Observed band size: 95 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human bladder cancer tissue stained for CEP95 using ab230305 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon-cancer tissue stained for CEP95 using ab230305 at 1/100 dilution in immunohistochemical analysis.

References

ab230305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up