Anti-CERKL antibody (ab222828)
Key features and details
- Rabbit polyclonal to CERKL
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-CERKL antibody
See all CERKL primary antibodies -
Description
Rabbit polyclonal to CERKL -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human CERKL aa 1-558.
Sequence:MPWRRRRNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRG IFEIGRDSCDVVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKDIFS VKLKRRCSVKQQRSGTLLGITLFICLKKEQNKLKNSTLDLINLSEDHCDI WFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIK TDVTIMEYEGHALSLLKECELQGFDGGHRKPLFAIHWSVQRLFTGMQTLE PSVVCVGGDGSASEVAHALLLRAQKNAGMETDRILTPVRAQLPLGLIPAG STNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAMF GFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNSSDD VQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRL NNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPR NNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGG SMEEMIPK
Database link: Q49MI3 -
Positive control
- WB: Mouse lung tissue lysate. IHC-P: Human prostate cancer and pancreatic tissues. ICC/IF: MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab222828 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. | |
WB | 1/1000 - 1/5000. Detects a band of approximately 63 kDa (predicted molecular weight: 20,25,43,48,53,58,60,63 kDa). |
Target
-
Function
Has no detectable ceramide-kinase activity. Overexpression of CERKL protects cells from apoptosis in oxidative stress conditions. -
Tissue specificity
Isoform 1 and isoform 2 are expressed in adult retina, liver and pancreas as well as in fetal brain, lung and kidney. Isoform 3 is expressed in adult retina as well as in fetal lung and liver. Isoform 4 is expressed in adult retina, lung and kidney as well as in fetal lung and liver. Moderately expressed in retina, kidney, lung, testis, trachea, and pancreas. Weakly expressed in brain, placenta and liver. -
Involvement in disease
Defects in CERKL are the cause of retinitis pigmentosa type 26 (RP26) [MIM:608380]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP26 inheritance is autosomal recessive. -
Sequence similarities
Contains 1 DAGKc domain. -
Developmental stage
Expressed in fetal lung, kidney and brain. -
Post-translational
modificationsPhosphorylated on serine residues. -
Cellular localization
Cytoplasm. Nucleus > nucleolus. Enriched in nucleoli. May shuttle between nucleus and cytoplasm. Isoform 5 is not enriched in the nucleoli and Cytoplasm. Nucleus > nucleolus. Golgi apparatus > trans-Golgi network. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 375298 Human
- Entrez Gene: 228094 Mouse
- Omim: 608381 Human
- SwissProt: Q49MI3 Human
- Unigene: 715753 Human
-
Alternative names
- Ceramide kinase like protein antibody
- Ceramide kinase-like protein antibody
- CERKL antibody
see all
Images
-
Anti-CERKL antibody (ab222828) at 1/1000 dilution + Mouse lung tissue lysate
Secondary
Goat Anti-Rabbit IgG at 1/10000 dilution
Predicted band size: 20,25,43,48,53,58,60,63 kDa
Observed band size: 63 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CERKL antibody (ab222828)
Paraffin-embedded human prostate cancer tissue were stained for CERKL using ab222828 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CERKL antibody (ab222828)
Paraffin-embedded human pancreatic tissue stained for CERKL using ab222828 at 1/100 dilution in immunohistochemical analysis.
-
MCF7 (human breast adenocarcinoma cell line) cells stained for CERKL (green) using ab222828 at 1/100 dilution in ICC/IF.
Protocols
References (0)
ab222828 has not yet been referenced specifically in any publications.