Overview

  • Product name

    Anti-Ceruloplasmin antibody [C1]
    See all Ceruloplasmin primary antibodies
  • Description

    Mouse monoclonal [C1] to Ceruloplasmin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Ceruloplasmin aa 789-1065. N-terminal tag (Expressed in E.coli).
    Sequence:

    DSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHG VQTESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKD LYSGLIGPLIVCRRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTY SDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMG NEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLL HCHVTDHIHAGMETTYTVLQNEDTKSG


    Database link: P00450

  • Positive control

    • WB: Recombinant human Ceruloplasmin protein; Human serum. IHC-P: Human liver and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C1
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 122 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Ceruloplasmin is a blue, copper-binding (6-7 atoms per molecule) glycoprotein. It has ferroxidase activity oxidizing Fe(2+) to Fe(3+) without releasing radical oxygen species. It is involved in iron transport across the cell membrane.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Defects in CP are the cause of aceruloplasminemia (ACERULOP) [MIM:604290]. It is an autosomal recessive disorder of iron metabolism characterized by iron accumulation in the brain as well as visceral organs. Clinical features consist of the triad of retinal degeneration, diabetes mellitus and neurological disturbances.
    Note=Ceruloplasmin levels are decreased in Wilson disease, in which copper cannot be incorporated into ceruloplasmin in liver because of defects in the copper-transporting ATPase 2.
  • Sequence similarities

    Belongs to the multicopper oxidase family.
    Contains 3 F5/8 type A domains.
    Contains 6 plastocyanin-like domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CERU_HUMAN antibody
    • Ceruloplasmin antibody
    • CP 2 antibody
    • CP antibody
    • CP2 antibody
    • Ferroxidase antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for Ceruloplasmin using ab239530 at 30 μg/ml in immunohistochemical analysis. Vector red staining.

  • Paraffin-embedded human liver tissue stained for Ceruloplasmin using ab239530 at 30 μg/ml in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for Ceruloplasmin using ab239530 at 20 μg/ml in immunohistochemical analysis. Vector red staining.

  • Anti-Ceruloplasmin antibody [C1] (ab239530) at 5 µg/ml + Recombinant human Ceruloplasmin protein

    Predicted band size: 122 kDa

  • Anti-Ceruloplasmin antibody [C1] (ab239530) at 3 µg/ml + Human serum

    Predicted band size: 122 kDa

References

ab239530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up