Anti-CES3/TGH antibody (ab215045)
Key features and details
- Sheep polyclonal to CES3/TGH
- Suitable for: WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-CES3/TGH antibody
See all CES3/TGH primary antibodies -
Description
Sheep polyclonal to CES3/TGH -
Host species
Sheep -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Mouse CES3/TGH aa 19-561. NS0-derived
Sequence:YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPP QPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLY LNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTI QYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIF GESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVA TLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFL PTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAE GKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDL MADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGD EIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEY DQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHRE
Database link: Q8VCT4 -
Positive control
- Mouse lung tissue lysate.
-
General notes
This product was previously labelled as CES3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute the antibody with 100 uL sterile PBS and the final concentration is 500 ug/mL. Reconstituted antibody can be aliquoted and stored frozen at < -20 °C for at least for six months without detectable loss of activity -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
The IgG fraction of immunized serum was purified by antigen affinity chromatography and lyophilized from a 0.2 µm filtered solution in phosphate-buffered saline (PBS). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab215045 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/2000. Predicted molecular weight: 62 kDa. |
Target
-
Function
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows low catalytic efficiency for hydrolysis of CPT-11 (7-ethyl-10-[4-(1-piperidino)-1-piperidino]-carbonyloxycamptothecin), a prodrug for camptothecin used in cancer therapeutics. -
Tissue specificity
Expressed in liver, colon and small intestine. -
Sequence similarities
Belongs to the type-B carboxylesterase/lipase family. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Endoplasmic reticulum lumen. - Information by UniProt
-
Database links
- Entrez Gene: 104158 Mouse
- Entrez Gene: 113902 Rat
- SwissProt: Q8VCT4 Mouse
- SwissProt: P16303 Rat
-
Alternative names
- Carboxylesterase 3 antibody
- CES 3 antibody
- Ces3 antibody
see all
Images
Datasheets and documents
References (0)
ab215045 has not yet been referenced specifically in any publications.