Overview

  • Product name

    Anti-CFDP1 antibody
  • Description

    Rabbit polyclonal to CFDP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CFDP1 aa 1-299.
    Sequence:

    MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQG KKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGI GSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVK AEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEK PQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWES FKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP


    Database link: Q9UEE9

  • Positive control

    • IHC-P: Human bladder cancer and adrenal gland tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab225909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May play a role during embryogenesis.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 BCNT-C domain.
  • Post-translational
    modifications

    Phosphorylated by CK2 (casein kinase II) in vitro.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCNT antibody
    • Bucentaur antibody
    • CENP-29 antibody
    • CFDP1 antibody
    • CFDP1_HUMAN antibody
    • CP27 antibody
    • Craniofacial development protein 1 antibody
    • p97 antibody
    • Phosphoprotein (Bucentaur) antibody
    • SWC5 antibody
    • Yeti antibody
    see all

Images

  • Paraffin-embedded human bladder cancer tissue stained for CFDP1 using ab225909 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for CFDP1 using ab225909 at 1/100 dilution in immunohistochemical analysis.

References

ab225909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up