Overview

  • Product name

    Anti-CFHR4 antibody - N-terminal
  • Description

    Rabbit polyclonal to CFHR4 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CFHR4 aa 11-60 (N terminal). The exact sequence is proprietary.
    Sequence:

    LWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF


    Database link: Q92496

  • Positive control

    • 721_B whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Contains 5 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CFHL4 antibody
    • CFHR4 antibody
    • Complement factor H related 4 antibody
    • Complement factor H-related protein 4 antibody
    • FHR-4 antibody
    • FHR4 antibody
    • FHR4_HUMAN antibody
    see all

Images

  • Anti-CFHR4 antibody - N-terminal (ab179646) at 1 µg/ml + 721_B whole cell lysate at 10 µg

    Predicted band size: 65 kDa

References

ab179646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up