Overview

  • Product name

    Anti-cGAS antibody [CL3605]
    See all cGAS primary antibodies
  • Description

    Mouse monoclonal [CL3605] to cGAS
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human cGAS aa 348-424.
    Sequence:

    RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCE NKEEKCCRKDCLKLMKYLLEQLKERF


    Database link: Q8N884

  • Positive control

    • WB: THP-1 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    CL3605
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab242363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

  • Function

    Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP. Catalysis involves both the formation of a 2',5' phosphodiester linkage at the GpA step and the formation of a 3',5' phosphodiester linkage at the ApG step, producing c[G(2',5')pA(3',5')p]. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of double-stranded DNA (dsDNA) in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production.
  • Tissue specificity

    Expressed in the monocytic cell line THP1.
  • Sequence similarities

    Belongs to the mab-21 family.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • C6orf150 antibody
    • cGAMP synthase antibody
    • cGAS antibody
    • CGAS_HUMAN antibody
    • cGMP Synthase antibody
    • Chromosome 6 open reading frame 150 antibody
    • Cyclic GMP-AMP synthase antibody
    • h-cGAS antibody
    • Hypothetical protein LOC115004 antibody
    • Mab 21 domain containing 1 antibody
    • Mab-21 domain-containing protein 1 antibody
    • MB21D1 antibody
    • MGC131892 antibody
    • MGC142166 antibody
    • MGC142168 antibody
    • OTTHUMP00000016743 antibody
    • OTTHUMP00000039330 antibody
    • protein MB21D1 antibody
    • Uncharacterized protein C6orf150 antibody
    see all

Images

  • Anti-cGAS antibody [CL3605] (ab242363) at 1 µg/ml + THP-1 (Human monocytic leukemia cell line) whole cell lysate

    Predicted band size: 59 kDa

References

ab242363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up