Overview

  • Product name

    Anti-CGGBP1 antibody - N-terminal
    See all CGGBP1 primary antibodies
  • Description

    Rabbit polyclonal to CGGBP1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CGGBP1 aa 1-81 (N terminal).
    Sequence:

    MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVL NHVRKSAISDHLKSKTHTKRKAEFEEQNVRK


    Database link: Q9UFW8

  • Positive control

    • IHC-P: Human placenta tissue. WB: RT4, U-251 MG sp, NIH/3T3 and NBT-II cell lysates. IHC-P: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 19 kDa.

Target

  • Function

    Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.
  • Tissue specificity

    Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
  • Developmental stage

    Expressed in fetal brain and kidney. Lower expression in fetal liver and lung.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 20 kDa CGG binding protein antibody
    • 20 kDa CGG-binding protein antibody
    • CGBP1_HUMAN antibody
    • CGG binding protein 1 antibody
    • CGG triplet repeat binding protein 1 antibody
    • CGG triplet repeat-binding protein 1 antibody
    • CGG-binding protein 1 antibody
    • CGGBP 1 antibody
    • CGGBP antibody
    • Cggbp1 antibody
    • OTTHUMP00000213853 antibody
    • OTTHUMP00000213877 antibody
    • p20 CGG binding protein antibody
    • p20 CGGBP antibody
    • p20 CGGBP DNA binding protein antibody
    • p20-CGGBP DNA-binding protein antibody
    see all

Images

  • All lanes : Anti-CGGBP1 antibody - N-terminal (ab224497) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 19 kDa

  • Paraffin-embedded human placenta tissue stained for CGGBP1 using ab224497 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-CGGBP1 antibody - N-terminal (ab224497) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 19 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CGGBP1 (green) using ab224497 at 4 µg/ml in ICC/IF.

References

ab224497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up