Overview

  • Product name

    Anti-CGNL1/Paracingulin antibody
  • Description

    Rabbit polyclonal to CGNL1/Paracingulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CGNL1/Paracingulin aa 659-746.
    Sequence:

    NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLS EMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK


    Database link: Q0VF96

  • Positive control

    • RT-4 and U251 MG cell lysate. Human kidney tissue. U251 MG cells.
  • General notes

     This product was previously labelled as CGNL1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 149 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in anchoring the apical junctional complex, especially tight junctions, to actin-based cytoskeletons.
  • Tissue specificity

    Smooth muscle, spleen, testis, fetal brain, amygdala, corpus callosum, cerebellum, thalamus and subthalamic nucleus of adult brain.
  • Involvement in disease

    A chromosomal aberration involving CGNL1 is a cause of aromatase excess syndrome [MIM:139300]. This is characterized by an estrogen excess due to an increased aromatase activity. An inversion on inv(15)(q21.2;q21.3) moves the promoter of the CGNL1 gene into a 5-prime position in relation to the aromatase coding region.
  • Sequence similarities

    Belongs to the cingulin family.
  • Domain

    The head region is responsible for junction-based distribution.
  • Cellular localization

    Cell junction > tight junction. Localizes to the apical junction complex composed of tight and adherens junctions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cgnl1 antibody
    • CGNL1_HUMAN antibody
    • Cingulin like 1 antibody
    • Cingulin-like protein 1 antibody
    • FLJ14957 antibody
    • JACOP antibody
    • Junction-associated coiled-coil protein antibody
    • KIAA1749 antibody
    • MGC138254 antibody
    • Paracingulin antibody
    see all

Images

  • Immunofluorescence analysis of formalin fixed, Triton X-100 permealized U251 MG cells, labeling CGNL1/Paracingulin with ab204500 at 4 µg/mL.

  • All lanes : Anti-CGNL1/Paracingulin antibody (ab204500) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U251 MG cell lysate

    Predicted band size: 149 kDa

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human kidney tissue sections labeling CGNL1/Paracingulin with ab204500 at a 1/1000 dilution.

References

ab204500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up