Overview

  • Product name
  • Description
    Goat polyclonal to CGRP
  • Host species
    Goat
  • Specificity
    There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin
  • Tested applications
    Suitable for: RIAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:

    ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF

    , corresponding to C terminal amino acids 82-118 of Human CGRP.

Properties

Applications

Our Abpromise guarantee covers the use of ab14180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
RIA 1/3000.

Target

  • Relevance
    CGRP is present in C-cells of the thyroid and in central and peripheral nerves. CGRP has several important physiologic roles: it is a potent vasodilator, and can affect the force and rate of heart beat; it can modulate acetylcholine receptor function at the neuromuscular junction; it has been demonstrated to block tolerance to morphine; and it can modulate antigen presentation in Langerhans cells in the skin. Despite these important physiologic functions, therapeutic strategies using CGRP have been impeded due to the lack of a cloned CGRP receptor with which ligands could be developed.
  • Cellular localization
    Endoplasmic reticulum and Secreted
  • Database links
  • Alternative names
    • Calcitonin/calcitonin related polypeptide alpha antibody
    • Alpha type CGRP antibody
    • Beta type CGRP antibody
    • CALC1 antibody
    • CALC2 antibody
    • CALCA antibody
    • CALCB antibody
    • Calcitonin 1 antibody
    • Calcitonin 2 antibody
    • Calcitonin gene related peptide I antibody
    • Calcitonin gene related peptide II antibody
    • Calcitonin related polypeptide alpha antibody
    • Calcitonin related polypeptide beta antibody
    • CGRP antibody
    • CGRP I antibody
    • CGRP II antibody
    • CGRP1 antibody
    • CGRP2 antibody
    • CT antibody
    • Katacalcin antibody
    • KC antibody
    see all

References

This product has been referenced in:
  • Garratt LW  et al. Matrix metalloproteinase activation by free neutrophil elastase contributes to bronchiectasis progression in early cystic fibrosis. Eur Respir J 46:384-94 (2015). Read more (PubMed: 25929954) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Question
Answer

Thank you for contacting us. We have several antibodies capable of detecting both alpha and beta CGRP, but none appear likely to be able to distinguish between alpha and beta, judging from the immunogens they are raised against. The immunogens are either amino acid sequences that are present in both alpha and beta, or full-length CGRP that is not characterized as alpha or beta. Some of the immunogen sequences are more conserved in one than the other, but there is no data to suggest that the antibody has specificity for one to the exclusion of the other. For example, a BLAST search of the immunogen used to generate ab14180 shows that it is derived from human CGRP beta, but it has 91% identity with human CGRP alpha. It is likely that the antibody recognizes both, but this has not been confirmed. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for your enquiry. I have examined each of the antibodies against one another with respect to your application of ICC in murine cells. ab10987 is a monoclonal antiserum that recognizes 10 amino acids in the C-terminus and recognizes human, rat and dog. I have performed a basic alignment and found that rat and mouse share a C-terminal sequence of GSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA compromising 100% identity in the terminal 55 amino acid residues. Therefore this antibody is very likely to cross react against murine CGRP. It has also been applied by ICC. ab22560 and ab14180 both share 96% identity overall and 89% identity of the epitope respectively when compared with the mouse amino acid sequence. These antisera are both polyclonal however and more likely to work given the accommodating nature of polyclonal antisera. However, they have not been applied using ICC. Given the identity in sequence between mouse and rat at the C-terminus and the fact that it has been tested by ICC, in my opinion ab10987 is your best option. As discussed on the telephone I would like to offer you a discount given that abcam can expand the species cross reactivity of this antibody on our datasheet, should you obtain favourable results. Please leave an Abreview by navigating to the antibody at abcam.com and clicking on the Abreview tab. I will follow this up in three months so we can determine how you got on. Please quote reference 30160 when you place the order to receive your discount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up