
  • Product name
  • Description
    Sheep polyclonal to CGRP
  • Host species
  • Specificity
    On rat spinal cord immunostaining may be abolished by preincubation with 10nmol CGRP (rat alpha) per mL diluted antiserum. Neither substance P nor galanin have any effect on immunostaining when used at 10nmol/mL diluted antiserum. It is believed that ab22560 cross-reacts with all known forms of rat and human CGRP.
  • Tested applications
    Suitable for: ICC/IF, IHC-FoFrmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Rat CGRP conjugated to Keyhole Limpet Haemocyanin (KLH).

  • Positive control
    • Rat spinal cord.


Associated products


Our Abpromise guarantee covers the use of ab22560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration. PubMed: 24042033
IHC-FoFr 1/2000 - 1/4000.


  • Relevance
    CGRP is present in C-cells of the thyroid and in central and peripheral nerves. CGRP has several important physiologic roles: it is a potent vasodilator, and can affect the force and rate of heart beat; it can modulate acetylcholine receptor function at the neuromuscular junction; it has been demonstrated to block tolerance to morphine; and it can modulate antigen presentation in Langerhans cells in the skin. Despite these important physiologic functions, therapeutic strategies using CGRP have been impeded due to the lack of a cloned CGRP receptor with which ligands could be developed.
  • Cellular localization
    Endoplasmic reticulum and Secreted
  • Database links
  • Alternative names
    • Calcitonin/calcitonin related polypeptide alpha antibody
    • Alpha type CGRP antibody
    • Beta type CGRP antibody
    • CALC1 antibody
    • CALC2 antibody
    • CALCA antibody
    • CALCB antibody
    • Calcitonin 1 antibody
    • Calcitonin 2 antibody
    • Calcitonin gene related peptide I antibody
    • Calcitonin gene related peptide II antibody
    • Calcitonin related polypeptide alpha antibody
    • Calcitonin related polypeptide beta antibody
    • CGRP antibody
    • CGRP I antibody
    • CGRP II antibody
    • CGRP1 antibody
    • CGRP2 antibody
    • CT antibody
    • Katacalcin antibody
    • KC antibody
    see all


  • Vibratome (70 µm) sections of rat spinal cord immunostained with sheep polyclonal antiserum to CGRP at a dilution of 1:1000. Negative images of fluorescence detection procedure (Alexa488 conjugated secondary antibody). Micrograph courtesy of Professor Andrew Todd (university of Glasgow).


This product has been referenced in:
  • Wang D  et al. Functional Divergence of Delta and Mu Opioid Receptor Organization in CNS Pain Circuits. Neuron 98:90-108.e5 (2018). Read more (PubMed: 29576387) »
  • Ozawa A  et al. Analysis of the distribution of spinal NOP receptors in a chronic pain model using NOP-eGFP knock-in mice. Br J Pharmacol 175:2662-2675 (2018). Read more (PubMed: 29582417) »
See all 13 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A


I am very pleased to hear you would like to accept our offer and test ab22560 in mouse. This code will give you 1 free mouse before the expiration date. To redeem this offer, please submit an Abreview for mouse and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.  

Read More


Thank you for your enquiry. I have examined each of the antibodies against one another with respect to your application of ICC in murine cells. ab10987 is a monoclonal antiserum that recognizes 10 amino acids in the C-terminus and recognizes human, rat and dog. I have performed a basic alignment and found that rat and mouse share a C-terminal sequence of GSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA compromising 100% identity in the terminal 55 amino acid residues. Therefore this antibody is very likely to cross react against murine CGRP. It has also been applied by ICC. ab22560 and ab14180 both share 96% identity overall and 89% identity of the epitope respectively when compared with the mouse amino acid sequence. These antisera are both polyclonal however and more likely to work given the accommodating nature of polyclonal antisera. However, they have not been applied using ICC. Given the identity in sequence between mouse and rat at the C-terminus and the fact that it has been tested by ICC, in my opinion ab10987 is your best option. As discussed on the telephone I would like to offer you a discount given that abcam can expand the species cross reactivity of this antibody on our datasheet, should you obtain favourable results. Please leave an Abreview by navigating to the antibody at abcam.com and clicking on the Abreview tab. I will follow this up in three months so we can determine how you got on. Please quote reference 30160 when you place the order to receive your discount.

Read More


Sign up