Overview

  • Product name

    Anti-CGT antibody
  • Description

    Rabbit polyclonal to CGT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CGT aa 43-172.
    Sequence:

    SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRN IFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDM CGFVIAHLLGVKYAVFSTGLWYPAEVGAPA


    Database link: Q16880

  • Positive control

    • IHC-P: Human cerebral cortex tissue.
  • General notes

     This product was previously labelled as UGT8

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system.
  • Pathway

    Sphingolipid metabolism; galactosylceramide biosynthesis.
  • Sequence similarities

    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 hydroxyacylsphingosine 1 beta galactosyltransferase antibody
    • 2-hydroxyacylsphingosine 1-beta-galactosyltransferase antibody
    • Ceramide UDP galactosyltransferase antibody
    • Ceramide UDP-galactosyltransferase antibody
    • Cerebroside synthase antibody
    • CGT antibody
    • CGT_HUMAN antibody
    • mCerGT antibody
    • UDP galactose ceramide galactosyltransferase antibody
    • UDP galactose ceramide galactosyltransferase 8 antibody
    • UDP glycosyltransferase 8 antibody
    • UDP-galactose-ceramide galactosyltransferase antibody
    • UGT4 antibody
    • Ugt8 antibody
    • Uridine diphosphate glycosyltransferase 8 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex stained for CGT using ab224092 at 1/20 dilution in immunohistochemical analysis.

References

ab224092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up