Overview

  • Product name

  • Description

    Rabbit polyclonal to CHAD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human CHAD aa 23-359. Full length mature chain without signal peptide.
    Sequence:

    CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFR AMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDL TELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKD LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVE ELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKH VHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRP DATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH


    Database link: O15335

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human adrenal gland tissue stained for CHAD with ab238551 at a 1/100 dilution in immunohistochemical analysis.

References

ab238551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up