Overview

  • Product name

  • Description

    Mouse polyclonal to CHAMP
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CHAMP aa 1-812.
    Sequence:

    MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLG KMIFYQKSAKLFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLN KETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTP LTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPPKSVPVCESQKLA PVPSPEPQKPAPVSPESVKATLSNPKPQKQSHFPETLGPPSASSPESPVL AASPEPWGPSPAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP RRPAPAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKP IPSVSPGPWKPTPSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKT APTLSPEHWKAVPPVSPELRKPGPPLSPEIRSPAGSPELRKPSGSPDLWK LSPDQRKTSPASLDFPESQKSSRGGSPDLWKSSFFIEPQKPVFPETRKPG PSGPSESPKAASDIWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKRAL FPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEEL LASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQE SSSDQEQVDVESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAK YMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLE SLLKNHVAAHGQSLLKCPRCNFESNFPRGFKKHLTHCQSRHNEEANKKLM EALEPPLEEQQI


    Database link: NP_115812.1

  • Positive control

    • CHAMP transfected 293T cell line; HeLa cells.
  • General notes

     This product was previously labelled as C13orf8

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 89 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Required for proper alignment of chromosomes at metaphase and their accurate segregation during mitosis. Involved in the maintenance of spindle microtubules attachment to the kinetochore during sister chromatid biorientation. May recruit CENPE and CENPF to the kinetochore.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated by CDK1. Mitotic phosphorylation is required for the attachment of spindle microtubules to the kinetochore.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • C13orf8 antibody
    • CAMP antibody
    • CHAMP antibody
    • CHAMP1 antibody
    • CHAP1_HUMAN antibody
    • chromosome 13 open reading frame 8 antibody
    • Chromosome alignment-maintaining phosphoprotein 1 antibody
    • FLJ90413 antibody
    • KIAA1802 antibody
    • Zinc finger protein 828 antibody
    • Zinc finger protein KIAA1802 antibody
    • ZNF828 antibody
    see all

Images

  • All lanes : Anti-CHAMP antibody (ab169249) at 1 µg/ml

    Lane 1 : CHAMP transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Lane 1 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
    Lane 2 : Goat Anti-Mouse IgG (H&L)-HRP
    at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 89 kDa

  • Immunofluorescent analysis of HeLa cells labeling CHAMP with ab169249 at 10 µg/ml.

References

ab169249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Whole cell lysate prepared in RIPA buffer)
Gel Running Conditions
Reduced Denaturing (4-12% precast Bis-Tris gel)
Loading amount
35 µg
Treatment
Control HeLa cells and HeLa cells over-expressing ZNF828
Specification
Whole cell lysate prepared in RIPA buffer
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 27 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up