Overview

  • Product name

  • Description

    Rabbit polyclonal to CHAMP
  • Host species

    Rabbit
  • Specificity

    This antibody recognizes CHAMP

  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human CHAMP aa 261-310 (internal sequence).
    Sequence:

    PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG

  • Positive control

    • Daudi cell lysate. Human skeletal muscle cells.
  • General notes

     This product was previously labelled as C13orf8

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab48703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 89 kDa (predicted molecular weight: 89 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Required for proper alignment of chromosomes at metaphase and their accurate segregation during mitosis. Involved in the maintenance of spindle microtubules attachment to the kinetochore during sister chromatid biorientation. May recruit CENPE and CENPF to the kinetochore.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated by CDK1. Mitotic phosphorylation is required for the attachment of spindle microtubules to the kinetochore.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • C13orf8 antibody
    • CAMP antibody
    • CHAMP antibody
    • CHAMP1 antibody
    • CHAP1_HUMAN antibody
    • chromosome 13 open reading frame 8 antibody
    • Chromosome alignment-maintaining phosphoprotein 1 antibody
    • FLJ90413 antibody
    • KIAA1802 antibody
    • Zinc finger protein 828 antibody
    • Zinc finger protein KIAA1802 antibody
    • ZNF828 antibody
    see all

Images

  • Anti-CHAMP antibody (ab48703) at 0.25 µg/ml + Daudi cell lysate at 10 µg with 5% skimmed milk in PBS

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 89 kDa
    Observed band size: 89 kDa



    Gel concentration: 12%
  • ab48703 (4-8µg/ml) staining of Human muscle tissue cells (10µg) with positively stained skeletal muscle cells (arrows). Magnification: x400

References

ab48703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab48703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up