Anti-Chaperone protein HtpG antibody (ab225994)

Overview

  • Product name

    Anti-Chaperone protein HtpG antibody
  • Description

    Rabbit polyclonal to Chaperone protein HtpG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Chaperone protein HtpG aa 1-624.
    Sequence:

    MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRA LSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKS GTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPEN GVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKY SDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFY KHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLY VQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRN ALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLL RFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELL RKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDES AKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQM AKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQA LLAERGTLEDPNLFIRRMNQLLVS


    Database link: P0A6Z3

  • Positive control

    • WB: Recombinant Escherichia coli Chaperone protein HtpG protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Images

  • All lanes : Anti-Chaperone protein HtpG antibody (ab225994) at 1/500 dilution

    Lane 1 : Recombinant Escherichia coli Chaperone protein HtpG protein 80 ng
    Lane 2 : Recombinant Escherichia coli Chaperone protein HtpG protein 40 ng
    Lane 3 : Recombinant Escherichia coli Chaperone protein HtpG protein 20 ng
    Lane 4 : Recombinant Escherichia coli Chaperone protein HtpG protein 10 ng

    Developed using the ECL technique.


    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab225994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up