Overview

  • Product name

  • Description

    Rabbit polyclonal to Chd1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Immunogen

    Recombinant fragment corresponding to Human Chd1 aa 1501-1710.
    Sequence:

    IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHL TQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSD REKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYT HHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKST PEHTWSSRKT


    Database link: O14646

  • Positive control

    • IHC-P: Human breast cancer and placenta tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    ATP-dependent chromatin-remodeling factor which functions as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. Regulates polymerase II transcription. Also required for efficient transcription by RNA polymerase I, and more specifically the polymerase I transcription termination step. Regulates negatively DNA replication. Not only involved in transcription-related chromatin-remodeling, but also required to maintain a specific chromatin configuration across the genome. Is also associated with histone deacetylase (HDAC) activity (By similarity). Required for the bridging of SNF2, the FACT complex, the PAF complex as well as the U2 snRNP complex to H3K4me3. Functions to modulate the efficiency of pre-mRNA splicing in part through physical bridging of spliceosomal components to H3K4me3. Required for maintaining open chromatin and pluripotency in embryonic stem cells.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 2 chromo domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain

    The 2 chromodomains are involved in the binding to the histone H3 methyllysine at position 4 (H3K4me3).
  • Cellular localization

    Nucleus. Cytoplasm. Is released into the cytoplasm when cells enter mitosis and is reincorporated into chromatin during telophase-cytokinesis.
  • Information by UniProt
  • Alternative names

    • ATP dependent helicase CHD 1 antibody
    • ATP-dependent helicase CHD1 antibody
    • CHD 1 antibody
    • CHD-1 antibody
    • Chd1 antibody
    • CHD1_HUMAN antibody
    • Chromodomain helicase DNA binding protein 1 antibody
    • Chromodomain-helicase-DNA-binding protein 1 antibody
    • DKFZp686E2337 antibody
    • OTTHUMP00000222625 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Chd1 using ab236287 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for Chd1 using ab236287 at 1/100 dilution in immunohistochemical analysis.

References

ab236287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up