Overview

  • Product name
  • Description
    Rabbit polyclonal to Chemerin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Chemerin aa 107-152. The exact sequence is proprietary.
    Sequence:

    EDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPG


    Database link: Q99969

  • Positive control
    • A549, Raw 264.7 and H9C2 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab201292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 19 kDa.

Target

  • Tissue specificity
    Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • HP10433 antibody
    • RAR responsive protein TIG2 antibody
    • RAR-responsive protein TIG2 antibody
    • RARR2_HUMAN antibody
    • RARRES2 antibody
    • Retinoic acid receptor responder (tazarotene induced) 2 antibody
    • Retinoic acid receptor responder 2 antibody
    • Retinoic acid receptor responder protein 2 antibody
    • Tazarotene induced gene 2 protein antibody
    • Tazarotene-induced gene 2 protein antibody
    • TIG2 antibody
    see all

Images

  • All lanes : Anti-Chemerin antibody (ab201292)

    Lane 1 : A549 whole cell lysate
    Lane 2 : Raw 264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 19 kDa

References

This product has been referenced in:
  • Wang Y  et al. Chemerin/ChemR23 axis triggers an inflammatory response in keratinocytes through ROS-sirt1-NF-?B signaling. J Cell Biochem N/A:N/A (2018). Read more (PubMed: 30426542) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up