For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    chip-kit-plants-ab117137.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Assays & Kits ChIP Related Products
Share by email

ChIP Kit - Plants (ab117137)

  • Datasheet
  • SDS
  • Protocol Booklet
Submit a review Q&A (13)References (6)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ChIP - ChIP Kit - Plants (ab117137)
  • ChIP - ChIP Kit - Plants (ab117137)

Key features and details

  • Assay type: Quantitative
  • Assay time: 6 hr

You may also be interested in

ChIP
Product image
Chromatin Extraction Kit (ab117152)
Primary
Product image
Anti-Histone H3 antibody - Nuclear Marker and ChIP Grade (ab1791)
Primary
Product image
Anti-Histone H3 (tri methyl K36) antibody - ChIP Grade (ab9050)

View more associated products

Overview

  • Product name

    ChIP Kit - Plants
    See all ChIP Kit kits
  • Assay type

    Quantitative
  • Assay time

    6h 00m
  • Species reactivity

    Reacts with: Plants
  • Product overview

    Protein-DNA interactions play a critical role for cellular functions such as signal transduction, gene transcription and epigenetic silencing. In plants, interactions between the DNA-binding proteins and cognate promoter sequences are primary determinants in establishing spatial and temporal expression patterns of gene that affect homeostasis, development, and adaptation.


    Abcam's ChIP Kit - Plants (ab117137) offers an advantageous tool for identifying direct genome-wide associations between specific regulatory proteins and their target genes in plant cells within 6 hours. The kit is suitable for combining the specificity of immunoprecipitation with qualitative and quantitative PCR, MS-PCR, DNA sequencing and southern blot, as well as DNA microarray.


    This kit is designed for 24 or 48 ChIP reactions, not for 24 or 48 samples. The standard protocol of the kit allows for performing 8 reactions with one sample. For testing more samples, the amount of each sample should be reduced. The amount of each reagent used for chromatin preparation should be also proportionally reduced.

  • Notes

    ChIP assay products and guides

    Find more ChIP assay / chromatin immunoprecipitation resources and products, ChIP antibody products, and other ChIP assay kits and related reagents.

  • Tested applications

    Suitable for: ChIPmore details

Properties

  • Storage instructions

    Please refer to protocols.
  • Components 24 tests 48 tests
    100X Protease Inhibitor Cocktail 1 x 25µl 1 x 50µl
    5X Lysis Buffer I 1 x 12ml 1 x 24ml
    8-Well Assay Strips (with Frame) 3 units 6 units
    8-Well Strip Caps 3 units 6 units
    Antibody Buffer 1 x 15ml 1 x 30ml
    Anti-H3K9me2 (1 mg/mL) 1 x 5µl 1 x 8µl
    Binding Buffer 1 x 5ml 1 x 8ml
    ChIP Dilution Buffer 1 x 2ml 1 x 6ml
    DNA Release Buffer 1 x 2ml 2 x 2ml
    Elution Buffer 1 x 0.6ml 1 x 1.2ml
    F-Collection Tube 30 units 50 units
    F-Spin Column 30 units 50 units
    Lysis Buffer II 1 x 3ml 1 x 6ml
    Lysis Buffer III 1 x 2ml 1 x 4ml
    Lysis Buffer IV 1 x 1.5ml 1 x 5ml
    Normal Mouse IgG (1 mg/mL) 1 x 10µl 1 x 10µl
    Proteinase K (10 mg/mL) 1 x 25µl 1 x 50µl
    Reverse Buffer 1 x 2ml 2 x 2ml
    Wash Buffer 1 x 28ml 2 x 28ml
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Assays & Kits
    • ChIP Related Products
    • Kits/ Lysates/ Other
    • Kits
    • Epigenetic kits
    • ChIP Kits
    • Epigenetics and Nuclear Signaling
    • ChIP assays
    • ChIP kits

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab117137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP
Use at an assay dependent concentration.
Notes
ChIP
Use at an assay dependent concentration.

Images

  • ChIP - ChIP Kit - Plants (ab117137)
    ChIP - ChIP Kit - Plants (ab117137)Image from Hufnagel et al., Nat Commun.;11(1):492. doi: 10.1038/s41467-019-14197-9. Reproduced under the Creative Commons license https://creativecommons.org/licenses/by/4.0/

    Repeated elements abundance in White Lupin genome. Chromatin immunoprecipitation experiments were done with ChIP Kit - Plants (ab117137). Sonicated chromatin-DNA ranging from 200-1000 bp was immunoprecipitated using anti-LalbCENH3. LalbCENH3-ChIPseq reads mapped against the first 100 RepeatExplorer clusters of the White Lupin genome. The main centromeric sequences found in LalbCENH3-ChIPseq are highlighted.

  • ChIP - ChIP Kit - Plants (ab117137)
    ChIP - ChIP Kit - Plants (ab117137)Image from Kim et al., Front Plant Sci.,11:589707. doi: 10.3389/fpls.2020.589707. Reproduced under the Creative Commons license https://creativecommons.org/licenses/by/4.0/

    ORE1 promoter-binding activity of GIGANTEA in the elf4 mutant relative to that in the wild type at amplicons 1, 2, and 3. ChIP assays were performed using the ChIP Kit-Plants (ab117137). Chromatin was immunoprecipitated using anti-GFP antibody (ab290)-bound assay plate for 90 min. The resulting immunoprecipitated DNA was subjected to qPCR to examine the enrichment of target genes. Three biological replicates were performed. Asterisks indicate significant differences (*p < 0.05, **p < 0.01, ***p < 0.005; Student's t-test).

Protocols

  • Protocol Booklet

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (6)

Publishing research using ab117137? Please let us know so that we can cite the reference in this datasheet.

ab117137 has been referenced in 6 publications.

  • Hufnagel B  et al. High-quality genome sequence of white lupin provides insight into soil exploration and seed quality. Nat Commun 11:492 (2020). PubMed: 31980615
  • Qin M  et al. Seed-Specific Overexpression of SPL12 and IPA1 Improves Seed Dormancy and Grain Size in Rice. Front Plant Sci 11:532771 (2020). PubMed: 33013960
  • Li W  et al. Three STIGMA AND STYLE STYLISTs Pattern the Fine Architectures of Apical Gynoecium and Are Critical for Male Gametophyte-Pistil Interaction. Curr Biol 30:4780-4788.e5 (2020). PubMed: 33007250
  • Kim H  et al. Subcellular Localization of GIGANTEA Regulates the Timing of Leaf Senescence and Flowering in Arabidopsis. Front Plant Sci 11:589707 (2020). PubMed: 33329652
  • Shi C  et al. Maternal control of suspensor programmed cell death via gibberellin signaling. Nat Commun 10:3484 (2019). PubMed: 31375676
  • Baker K  et al. Chromatin state analysis of the barley epigenome reveals a higher order structure defined by H3K27me1 and H3K27me3 abundance. Plant J N/A:N/A (2015). PubMed: 26255869

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-10 of 13 Abreviews or Q&A

Question

Inquiry: Dear Sir or Madam, is an MNase treatment instead of sonication for DNA shearing compatible with this kit? Are there any protocols provided yet? many thanks

Read More

Abcam community

Verified customer

Asked on Jun 16 2014

Answer



I am happy to confirm that this kit is compatible with chromatin sheared using MNase (generally at the concentration of 5 Unit/ml for 5-10 min).

However, based on our testing, MNase digestion should be well monitored and controlled (for fragmenting DNA within 200-1000 bps).

Otherwise, it may cause over-degradation of DNA so that the DNA yield is lower than that obtained with sonication. We also recommended to perform the enzyme reaction in a small volume followed by heat inactivation of the enzyme then continuing the protocol at step 8 (tissue lysis and DNA shearing section, page 10) .

Read More

Anja Hoffmann

Abcam Scientific Support

Answered on Jun 16 2014

Question

Covaris ultrasonicator compatible with this kit? What specific vacuum infiltration device is used (company and model number)?

Read More

Abcam community

Verified customer

Asked on Feb 20 2014

Answer

1. Yes, the Covaris sonicator is fully comatible with this kit.
2. The Desi-Vac desiccator (vacuum pump container, YO-06525-02) from Cole -Parmer would be fine.

Read More

Kevin Hanson

Abcam Scientific Support

Answered on Feb 20 2014

Question


Inquiry: Hello! I need to perform ChIP on Chlamydomonas reinhardtii. Could you suggest a ChIP kit that would be expected to perform best with this species? Thank you for your time.

Read More

Abcam community

Verified customer

Asked on Jan 08 2013

Answer

Thank you for contacting us. The ChIP kit ab117137 should be suitable for testing with Chlamydomonas reinhardtii.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Jan 08 2013

Question

Product code: 117137
Lot number: GR101683-1
Inquiry: Hi there, I have recently used your episeeker chip kit (plants) with much success in barley. However this second time around (with a new kit) the chromatin I have prepared (all done exactly as per instructions as in my first experiment) had a green pellet at the point in time where your protocol advises that it should be white - this is at the "Tissue Lysis and DNA shearing" Step 5. Can you advise why this might be and if it is likely to cause a problem in the downstream chip? I performed the crosslinking etc exactly as before according to your instructions. Many thanks, Look forward to hearing from you.

Read More

Abcam community

Verified customer

Asked on Nov 05 2012

Answer

Thank you for contacting us.

In general the chromatin extracts at the step of sonication should be clear. However in some of case, the green tinge may be seen to the chromatin extracts if the starting materials are with green color (ex: green
leaves). If the green color is seen in the pellet at each step including sonication, it could be caused by chlorophyll which is contained in the solution and may not be completely removed at each step. It is
also possible that tiny of chlorophyll is mixed in the pellet. However a green tinge to the chromatin extracts would not affect the chromatin immunoprecipitaion by antibody.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Abcam Scientific Support

Answered on Nov 05 2012

Question

The percentage input values I find in my experiment are very high.

Read More

Abcam community

Verified customer

Asked on Oct 08 2012

Answer

Could you also provide the Ct values for the EU-Hi region in both the IPd sample and input DNA?

Read More

Abcam Scientific Support

Answered on Oct 08 2012

Question

Hi there, I have recently performed a ChIP experiment using this kit with 4-day old barley seedlings cross-linked exactly as described in the instructions. Sonication was performed in a diagenode bioruptor using 10 cycles of 30 second pulses with a 60 second gap in between. This was performed at low power and gave fragments sizes of c.500bp. 4 x ChIP experiments were performed per biological replicate using IgG (provided with kit), H3 antibody, H3K9me1, H3K56ac. 3ul of each antibody was used per ChIP corresponding to protocol. 3ug per ChIP. ChIP was performed exactly as described in your instructions. I analysed my samples using a Q-PCR assay with primers characteristic of both "repressed" heterochromatic regions and "expressed" euchromatic regions which give expected results in terms of the histone modifications associated with each (at least they are in the right proportions). However, the percentage input values I find in my experiment are as a general rule very high - i.e. one primer pair gives a %input of 85%!!! I have never seen values as high as this in any experiment in the literature but there are few examples where your kit has been used. Have you ever heard of % input values as high as this before? Many thanks

Read More

Abcam community

Verified customer

Asked on Oct 04 2012

Answer

Thank you for contacting us.

I am sorry to hear you have been experiencing problems using our ChIP kit. In order to understand the problem in more detail would it be possible for you provide information to the following questions:

1. Total volume of diluted supernatant obtained at step 1 of " Protein/DNA immunoprecipitation"
2. Total volume of diluted supernatant used as "Input DNA"
3. Total volume of diluted supernatant used for sample IP
4. total volume of DNA elution for both sample and Input DNA
5. Total volume of both sample and Input DNA elution used for PCR.
6. Targeted gene by the primer pair that gives "high percentage" of input DNA.

Looking forward to your reply.

Read More

Abcam Scientific Support

Answered on Oct 04 2012

Question

1. The kit ab117137 provides 60 ml 1x ECP3C, however that would allow only 3 samples to be prepared for chromatin. But the kit says 24 tests.
2. Also, during the fixation step, the protocol notes the formaldehyde should "boil". How hard should this boil be?

Read More

Abcam community

Verified customer

Asked on Sep 11 2012

Answer

Thank you for your enquiry.

Regarding question 1:
You can reduce the volumes(and mass of plant tissue) accordingly to test moreplant samplesusing the samereagents provided with the kit. For example you can reduce the plant tissue by 10xand use 0.1g plant tissue per prep. Thiswould still produce sufficient chromatin for 1 ChIP.

Regarding question 2:
The "boiling" during fixation under vacum need not be a hard boil.Just a few bubbles produced is fine.

I hope this is helpful. Please contact me again if you have any further questions.

Read More

Abcam Scientific Support

Answered on Sep 11 2012

Question

Thanks for the answering my previous query.

I would also like to check whether if your product: ab817 antibody (Anti-RNA polymerase II CTD repeat YSPTSPS antibody [8WG16] - ChIP Grade) could be used against Populus trichocarpa (a tree) RNA Polymerase II protein for our ChIP-Seq experiment.

Here is the protein sequence of the query protein:


MNKKSSCCAICENSNRASICPICVNYRLNEYGTLLKSLNSRRDSLYSKLSVVLIAKGKADDQFNWRVQQNEKLASSREKLHRNKEQLAQGKAKVEKLSQD

LKKKNGMLESARNVLEKNRMEQLEKFYPNLICTQSLGHMAITSELLHKQSVVIKQICKLFPQRRVNVDGERNFSGQYDQICNARLPRGLDPHSVSSEELA

ASLGYMVQLLNLVAHNLAAPTLHNAGFAGSCSRIWQRDSYWNACPSSRSNEYPLFIPRQNYCSTSSENSWTDKSSSNFGVASMESERRPHLDSTRSNSFN

YSSVSPHSVETHKDLQKGVSLLKKSVACVTAYCYNLLCLDVPSDTSTFEAFAKLLSTLSSSKEVRSVFNLKMACSRSCKQVQKLNKSVWNVNSAISSSAL

LESAHALQLMKNTSDNNLPNSAASFLFATGISDGKNESFIDGWDLVEHPTFPPPPSQVEDIEHWTRAMFIDATKK

I sincerely appreciate your help.

Thanks again,

Read More

Abcam community

Verified customer

Asked on Jul 24 2012

Answer

Thank you very much for your reply.

The CTD repeat antibody, ab817, is expected to react with most species. We haven't specifically tested it against P. trichocarpa, however as long as the samples contain the CTD repeat I do expect it to react. The antibody does work in ChIPseq with samples from other species, so I also expect it to work with your samples.

I hope that this information will be useful, but please let me know if you have any further questions and I'll be happy to help.

Read More

Abcam Scientific Support

Answered on Jul 24 2012

Question

What kind of plant tissue has the kit been tested with?
Can roots be collected from PhytaGel and used with the kit?

Read More

Abcam community

Verified customer

Asked on Jul 19 2012

Answer

Thank you very much for your call earlier this week and for your patience while I have been in touch with the lab regarding your enquiry.

The kit was tested with samples fromArabidopsisi thaliana in the lab, and based on user feedback and published articles, other plants (leaves and seeds)such as petunia have also been used. In principle, the kit should be suitable for use with root samples, though we do not have any reports of this being done in the past.

I hope that this information will be useful, but if you have any further questions please let me know and I'll be happy to help.

Read More

Abcam Scientific Support

Answered on Jul 19 2012

Question

Thanks for your reply! The information is really helpful for me.
I had a glance of your primary antibody, most of them react with human,
mouse, and rat. If I need some for Arabidopsis, are they applicable? Or
you have a specific list of antibodies for Arabidopsis or plant?
Best,

Read More

Abcam community

Verified customer

Asked on Apr 27 2012

Answer

Thank you very much for your email.

I have put in the attachment the list of the antibodies we have currently in our catalog which are tested against Arabidopsis.

I would also like to make you aware of a 100% Abreview testing discount we offer on untested applications and species. If you are interested in purchasing a product that is not tested in a particular species or application then we can issue a discount off a future purchase if the product is purchased and feedback is given to us via our Abreview system. We would offer the second primary antibody with a 100% discount. The Terms and Conditions of this offer can be found at: https://www.abcam.com/collaborationdiscount. If you have any further questions about this offer, then please do let me know.

Please let me know against which targets you are searching an antibody for, and I can see, what antibody we have or which antibody might be suitable for testing. Please mention also the applications in which you would need to use this antibodies.

I hope this information is helpful. Please do not hesitate to contact us again, could we assist you further.

Read More

Abcam Scientific Support

Answered on Apr 27 2012

1-10 of 13 Abreviews or Q&A

  •  Previous
  • 1
  • 2
  • Next 

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.