Overview

  • Product name

  • Description

    Rabbit polyclonal to CHM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CHM aa 1-653.
    Sequence:

    MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASF SFSGLLSWLKEYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEV FCYASQDLHEDVEEAGALQKNHALVTSANSTEAADSAFLPTEDESLSTMS CEMLTEQTPSSDPENALEVNGAEVTGEKENHCDDKTCVPSTSAEDMSENV PIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSN VSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT FCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVMHSIAMTSETASS TIDGLKATKNFLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCL RHSVQCLVVDKESRKCKAIIDQFGQRIISEHFLVEDSYFPENMCSRVQYR QISRAVLITDRSVLKTDSDQQISILTVPAEEPGTFAVRVIELCSSTMTCM KGTYLVHLTCTSSKTAREDLESVVQKLFVPYTEMEIENEQVEKPRILWAL YFNMRDSSDISRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICP NEDFCPPPPNPEDIILDGDSLQPEASESSAIPEANSETFKESTNLGNLEE SSE


    Database link: P24386

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

Target

  • Function

    Binds unprenylated Rab proteins, presents it to the catalytic Rab GGTase dimer, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Also a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins; this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation.
  • Involvement in disease

    Defects in CHM are the cause of choroideremia (CHM) [MIM:303100]. An X-linked recessive disease characterized by a slowly progressive degeneration of the choroid, photoreceptors, and retinal pigment epithelium. Affected males develop night blindness in their teenage years followed by loss of peripheral vision and complete blindness at middle age. Carrier females are generally asymptomatic but funduscopic examination often shows patchy areas of chorioretinal atrophy.
  • Sequence similarities

    Belongs to the Rab GDI family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CHM antibody
    • Chm antibody
    • Choroideraemia protein antibody
    • Choroideremia antibody
    • DXS540 antibody
    • FLJ38564 antibody
    • GGTA antibody
    • HSD 32 antibody
    • MGC102710 antibody
    • Rab escort protein 1 antibody
    • Rab geranylgeranyltransferase component A antibody
    • Rab proteins geranylgeranyltransferase component A 1 antibody
    • RAE1_HUMAN antibody
    • REP 1 antibody
    • REP-1 antibody
    • REP1 antibody
    • TCD antibody
    • TCD protein antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for CHM using ab236722 at 1/100 dilution in immunohistochemical analysis.

References

ab236722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up