Overview

  • Product name

  • Description

    Rabbit polyclonal to CHMP7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CHMP7 aa 1-290.
    Sequence:

    MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWD SKMGFWAPLVLSHSRRQGVVRLRLRDLQEAFQRKGSVPLGLATVLQDLLR RGELQRESDFMASVDSSWISWGVGVFLLKPLKWTLSNMLGDNKVPAEEVL VAVELLKEKAEEVYRLYQNSPLSSHPVVALSELSTLCANSCPDERTFYLV LLQLQKEKRVTVLEQNGEKIVKFARGPRAKVSPVNDVDVGVYQLMQSEQL LSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQR


    Database link: Q8WUX9-1

  • Positive control

    • IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    CHMP7 plays a role in the endosomal sorting pathway and is a component of the ESCRT III complex.
  • Cellular localization

    Cytoplasm. Note: Diffused localization, with some punctate distribution, especially in the perinuclear area
  • Database links

  • Alternative names

    • Charged multivesicular body protein 7 antibody
    • CHMP family member 7 antibody
    • Chromatin modifying protein 7 antibody

Images

  • Paraffin-embedded human prostate cancer tissue stained for CHMP7 with ab238552 at a 1/100 dilution in immunohistochemical analysis.

References

ab238552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up