Overview

  • Product name

    Anti-CHRNA10 antibody
  • Description

    Rabbit polyclonal to CHRNA10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human CHRNA10 aa 25-240.
    Sequence:

    AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQ VLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADA QPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGS WTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYP DVTFTLLLRRRAAAYV


    Database link: Q9GZZ6

  • Positive control

    • WB: Jurkat and A549 whole cell lysate. IHC-P: Human tonsil and thymus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 50 kDa.

Target

  • Function

    Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma.
  • Tissue specificity

    Expressed in inner-ear tissue, tonsil, immortalized B-cells, cultured T-cells and peripheral blood lymphocytes.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-10/CHRNA10 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetylcholine receptor, neuronal nicotinic, alpha-10 subunit antibody
    • ACH10_HUMAN antibody
    • Alpha 10 nAChR antibody
    • Cholinergic receptor nicotinic alpha 10 antibody
    • Cholinergic receptor, neuronal nicotinic, alpha polypeptide 10 antibody
    • Cholinergic receptor, nicotinic, alpha polypeptide 10 antibody
    • CHRNA 10 antibody
    • CHRNA10 antibody
    • NACHR alpha 10 antibody
    • NACHR alpha-10 antibody
    • NACHRA10 antibody
    • Neuronal acetylcholine receptor protein subunit alpha 10 antibody
    • Neuronal acetylcholine receptor subunit alpha-10 antibody
    • Nicotinic acetylcholine receptor subunit alpha 10 antibody
    • Nicotinic acetylcholine receptor subunit alpha-10 antibody
    • OTTHUMP00000013620 antibody
    see all

Images

  • All lanes : Anti-CHRNA10 antibody (ab234767) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 50 kDa

  • Paraffin-embedded human tonsil tissue stained for CHRNA10 using ab234767 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thymus tissue stained for CHRNA10 using ab234767 at 1/100 dilution in immunohistochemical analysis.

References

ab234767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up