Anti-CHRND antibody [1H1F9] (ab233758)
Key features and details
- Mouse monoclonal [1H1F9] to CHRND
- Suitable for: WB, Flow Cyt
- Reacts with: Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-CHRND antibody [1H1F9]
See all CHRND primary antibodies -
Description
Mouse monoclonal [1H1F9] to CHRND -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human CHRND aa 22-245. Expressed in E.coli.
Sequence:LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEE TLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDG SFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSS LKYTAKEITLSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVN VDPRAPLDSPSRQDITFYLIIRRK
Database link: Q07001 -
Positive control
- WB: Recombinant human CHRND protein (AA: extra 22-245); C6 and CHRND (AA: extra 22-245)-hIgGFc transfected HEK-293 whole cell lysate. Flow: SK-N-SH cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
1H1F9 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab233758 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. | |
Flow Cyt | 1/200 - 1/400. |
Target
-
Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. -
Involvement in disease
Defects in CHRND are a cause of multiple pterygium syndrome lethal type (MUPSL) [MIM:253290]. Multiple pterygia are found infrequently in children with arthrogryposis and in fetuses with fetal akinesia syndrome. In lethal multiple pterygium syndrome there is intrauterine growth retardation, multiple pterygia, and flexion contractures causing severe arthrogryposis and fetal akinesia. Subcutaneous edema can be severe, causing fetal hydrops with cystic hygroma and lung hypoplasia. Oligohydramnios and facial anomalies are frequent.
Defects in CHRND are a cause of congenital myasthenic syndrome slow-channel type (SCCMS) [MIM:601462]. SCCMS is the most common congenital myasthenic syndrome. Congenital myasthenic syndromes are characterized by muscle weakness affecting the axial and limb muscles (with hypotonia in early-onset forms), the ocular muscles (leading to ptosis and ophthalmoplegia), and the facial and bulbar musculature (affecting sucking and swallowing, and leading to dysphonia). The symptoms fluctuate and worsen with physical effort. SCCMS is caused by kinetic abnormalities of the AChR, resulting in prolonged endplate currents and prolonged AChR channel opening episodes.
Defects in CHRND are a cause of congenital myasthenic syndrome fast-channel type (FCCMS) [MIM:608930]. FCCMS is a congenital myasthenic syndrome characterized by kinetic abnormalities of the AChR. In most cases, FCCMS is due to mutations that decrease activity of the AChR by slowing the rate of opening of the receptor channel, speeding the rate of closure of the channel, or decreasing the number of openings of the channel during ACh occupancy. The result is failure to achieve threshold depolarization of the endplate and consequent failure to fire an action potential. -
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily. -
Cellular localization
Cell junction > synapse > postsynaptic cell membrane. Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1144 Human
- Entrez Gene: 54240 Rat
- SwissProt: Q07001 Human
- SwissProt: P25110 Rat
- Unigene: 156289 Human
- Unigene: 41469 Rat
-
Alternative names
- Acetylcholine receptor delta subunit antibody
- Acetylcholine receptor subunit delta antibody
- ACHD_HUMAN antibody
see all
Images
-
Anti-CHRND antibody [1H1F9] (ab233758) at 1/500 dilution + Recombinant human CHRND (AA: extra 22-245)
Developed using the ECL technique. -
All lanes : Anti-CHRND antibody [1H1F9] (ab233758) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 2 : CHRND (AA: extra 22-245)-hIgGFc transfected HEK-293 whole cell lysate
Developed using the ECL technique. -
Anti-CHRND antibody [1H1F9] (ab233758) at 1/500 dilution + C6 (rat glial tumor cell line) whole cell lysate
Developed using the ECL technique. -
Flow cytometric analysis of SK-N-SH (human neuroblastoma cell line) cell line labeling CHRND with ab233758 at 1/200 dilution (green) compared with a negative control (green).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233758 has not yet been referenced specifically in any publications.