Overview

  • Product name

    Anti-Chromogranin A antibody [CGA414]
    See all Chromogranin A primary antibodies
  • Description

    Mouse monoclonal [CGA414] to Chromogranin A
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, IP, IHC-Fr, Flow Cyt, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Chromogranin A aa 19-457.
    Sequence:

    LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILS ILRHQNLLKE LQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAE LKEAVEEPSSKDVMEKREDSKE AEKSGEATDGARPQALPEPMQESKAE GNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQ AEGDSEGLSQGLVD REKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHP SL GYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMA VVPQGLFR GGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRL EGQEEEEDNRDSSMKLSFRA RAYGFRGPGPQLRRGWRPSSREDSLEAG LPLQVRGYPEEKKEEEGSANRRPEDQELESLS AIEAELEKVAHQLQAL RRG


    Database link: P10645

  • Positive control

    • Adrenal gland, bowel, thyroid, pancreas, or pheochromocytoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab187368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
IP Use at an assay dependent concentration.

1-2µg/500µg protein lysate

IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ICC/IF Use a concentration of 1 - 2 µg/ml.
WB Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 68-75 kDa (predicted molecular weight: 50 kDa).

Target

  • Function

    Pancreastatin strongly inhibits glucose induced insulin release from the pancreas.
  • Sequence similarities

    Belongs to the chromogranin/secretogranin protein family.
  • Post-translational
    modifications

    Sulfated on tyrosine residues and/or contains sulfated glycans.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted. Neuroendocrine and endocrine secretory granules.
  • Information by UniProt
  • Database links

  • Form

    According to the Swiss-Prot database, this protein has many different forms which correspond to various molecular weights; thus the possible variation from the predicted molecular weight of 51kDa.
  • Alternative names

    • beta Granin antibody
    • betagranin (N-terminal fragment of chromogranin A) antibody
    • catestatin antibody
    • CgA antibody
    • CHG A antibody
    • Chga antibody
    • chromofungin antibody
    • Chromogranin A antibody
    • Chromogranin A parathyroid secretory protein 1 antibody
    • Chromogranin A precursor antibody
    • ChromograninA antibody
    • CMGA_HUMAN antibody
    • ER-37 antibody
    • Pancreastatin antibody
    • Parastatin antibody
    • Parathyroid secretory protein 1 antibody
    • Pituitary secretory protein I antibody
    • Secretory protein I antibody
    • SP I antibody
    • SP-I antibody
    • SP1 antibody
    • SPI antibody
    • vasostatin 2 antibody
    • Vasostatin antibody
    • Vasostatin I antibody
    • Vasostatin II antibody
    • vasostatin-2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded formalin fixed pancreas tissue labeling Chromogranin A with ab187368 at 1 µg/µl.

References

ab187368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up