Overview

  • Product name

    Anti-Chromogranin A antibody [CGA/414] - BSA and Azide free
    See all Chromogranin A primary antibodies
  • Description

    Mouse monoclonal [CGA/414] to Chromogranin A - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Does not react with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Human Chromogranin A aa 19-457.
    Sequence:

    LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILS ILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELK EAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQ APGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLS AEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKG ESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFR GGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNR DSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEK KEEEGSANRRPEDQELESLS AIEAELEKVAHQLQALRRG


    Database link: P10645

  • Positive control

    • Human pancreas, small cell lung carcinoma, adrenal gland, bowel, thyroid and pheochromocytoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab212287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use a concentration of 0.5 - 1 µg/ml.

(in 0.1ml).

ICC/IF Use a concentration of 1 - 2 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Pancreastatin strongly inhibits glucose induced insulin release from the pancreas.
  • Sequence similarities

    Belongs to the chromogranin/secretogranin protein family.
  • Post-translational
    modifications

    Sulfated on tyrosine residues and/or contains sulfated glycans.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted. Neuroendocrine and endocrine secretory granules.
  • Information by UniProt
  • Database links

  • Form

    According to the Swiss-Prot database, this protein has many different forms which correspond to various molecular weights; thus the possible variation from the predicted molecular weight of 51kDa.
  • Alternative names

    • beta Granin antibody
    • betagranin (N-terminal fragment of chromogranin A) antibody
    • catestatin antibody
    • CgA antibody
    • CHG A antibody
    • Chga antibody
    • chromofungin antibody
    • Chromogranin A antibody
    • Chromogranin A parathyroid secretory protein 1 antibody
    • Chromogranin A precursor antibody
    • ChromograninA antibody
    • CMGA_HUMAN antibody
    • ER-37 antibody
    • Pancreastatin antibody
    • Parastatin antibody
    • Parathyroid secretory protein 1 antibody
    • Pituitary secretory protein I antibody
    • Secretory protein I antibody
    • SP I antibody
    • SP-I antibody
    • SP1 antibody
    • SPI antibody
    • vasostatin 2 antibody
    • Vasostatin antibody
    • Vasostatin I antibody
    • Vasostatin II antibody
    • vasostatin-2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas tissue labeling Chromogranin A with ab212287 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small cell lung carcinoma tissue labeling Chromogranin A with ab212287 at 1 µg/ml.

References

ab212287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up