Overview

  • Product name

  • Description

    Rabbit polyclonal to CHSS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CHSS2 aa 290-383.
    Sequence:

    GCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKA FARAELERTYQEIQELQWEIQNTSHLAVDGDRAAAWPVGIPAPS


    Database link: Q8IZ52

  • Positive control

    • IHC-P: Human small intestine tissue. WB: CHSS2 overexpression HEK-293T cell lysate. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 85 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    CHSS2 belongs to the chondroitin N-acetylgalactosaminyltransferase family. It has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity and transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer. CHSS2 is ubiquitous; highly expressed in pancreas, ovary, brain, heart, skeletal muscle, colon, kidney, liver, stomach, small intestine and placenta.
  • Cellular localization

    Golgi apparatus, golgi stack membrane; Single pass type II membrane protein.
  • Database links

  • Alternative names

    • Chondroitin glucuronyltransferase II antibody
    • Chondroitin polymerizing factor antibody
    • Chondroitin sulfate synthase 2 antibody
    • CHPF antibody
    • CHSY2 antibody
    • CSS2 antibody
    • Glucuronosyl N acetylgalactosaminyl proteoglycan 4 beta N acetylgalactosaminyltransferase II antibody
    • N acetylgalactosaminyl proteoglycan 3 beta glucuronosyltransferase II antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for CHSS2 using ab224495 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-CHSS2 antibody (ab224495) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : CHSS2 overepression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 85 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CHSS2 (green) using ab224495 at 4 µg/ml in ICC/IF.

References

ab224495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up