Overview

  • Product name

    Anti-CHST14 antibody
  • Description

    Rabbit polyclonal to CHST14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CHST14 aa 70-133.
    Sequence:

    PLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQ PGMPRDPWDLPVGQ


    Database link: Q8NCH0

  • Positive control

    • WB: A549 cell lysate. IHC-P: Human pancreatic cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab235056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Detects a band of approximately 43 kDa (predicted molecular weight: 43 kDa).

Target

  • Function

    Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. Transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. Transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. Has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
  • Tissue specificity

    Widely expressed. Expressed at high level in pituitary gland, placenta, uterus and thyroid.
  • Involvement in disease

    Defects in CHST14 are the cause of Ehlers-Danlos syndrome musculocontractural type (EDSMC) [MIM:601776]. It is a form of Ehlers-Danlos syndrome characterized by distinctive craniofacial dysmorphism, congenital contractures of thumbs and fingers, clubfeet, severe kyphoscoliosis, muscular hypotonia, hyperextensible thin skin with easy bruisability and atrophic scarring, wrinkled palms, joint hypermobility, and ocular involvement.
  • Sequence similarities

    Belongs to the sulfotransferase 2 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2600016L03Rik antibody
    • ATCS antibody
    • Carbohydrate (N acetylgalactosamine 4 0) sulfotransferase 14 antibody
    • Carbohydrate sulfotransferase 14 antibody
    • CHST14 antibody
    • CHSTE_HUMAN antibody
    • D4ST-1 antibody
    • D4st1 antibody
    • Dermatan 4-sulfotransferase 1 antibody
    • hD4ST1 antibody
    • RP23-286G12.2 antibody
    • UNQ1925/PRO4400 antibody
    see all

Images

  • Anti-CHST14 antibody (ab235056) at 1/500 dilution + A549 (human lung carcinoma cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for CHST14 using ab235056 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up