Anti-CHX10 antibody (ab16141)
Key features and details
- Sheep polyclonal to CHX10
- Suitable for: WB
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-CHX10 antibody
See all CHX10 primary antibodies -
Description
Sheep polyclonal to CHX10 -
Host species
Sheep -
Tested Applications & Species
Application Species WB MouseRat -
Immunogen
Recombinant fragment corresponding to Human CHX10 aa 264-361 (C terminal).
Sequence:EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKA QEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Database link: P58304 -
General notes
Chx10 is a 46kDa homeodomain protein of the paired-like class that is essential for development of the mammalian eye. Mutations in Chx10 cause microphthalmia, a cause of congenital blindness in humans, and the ocular retardation (or) phenotype in mice. In the developing mouse retina Chx10 is expressed in retinal progenitors, while in the mature retina, Chx10 expression becomes restricted to bipolar neurons. Concurrent with these expression patterns, the Chx10-/- (or) retina is thin due to a defect in proliferation of retinal progenitors, and lacks bipolar neurons. Chx10 is also expressed in the developing brainstem, thalamus, and spinal cord.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Ammonium Sulphate Precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
ChIP Related Products
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab16141 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
WB |
Mouse
Rat
|
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.
|
Notes |
---|
WB
Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa. |
Target
-
Function
Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells. -
Tissue specificity
Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate. -
Involvement in disease
Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2) [MIM:610093]; also known as isolated clinical anophthalmia. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present.
Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092].
Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3) [MIM:610092]; also known as isolated colobomatous microphthalmia 3. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure). -
Sequence similarities
Belongs to the paired homeobox family.
Contains 1 CVC domain.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 12677 Mouse
- Entrez Gene: 171360 Rat
- SwissProt: Q61412 Mouse
- Unigene: 4405 Mouse
- Unigene: 92414 Rat
-
Alternative names
- C elegans ceh 10 homeo domain containing homolog antibody
- Ceh 10 homeo domain containing homolog (C. elegans) antibody
- Ceh 10 homeo domain containing homolog antibody
see all
Images
Protocols
Datasheets and documents
References (10)
ab16141 has been referenced in 10 publications.
- Kumamaru H et al. Regenerating Corticospinal Axons Innervate Phenotypically Appropriate Neurons within Neural Stem Cell Grafts. Cell Rep 26:2329-2339.e4 (2019). PubMed: 30811984
- Chaimowicz C et al. Teashirt 1 (Tshz1) is essential for the development, survival and function of hypoglossal and phrenic motor neurons in mouse. Development 146:N/A (2019). PubMed: 31427287
- Kowalchuk AM et al. Requirements for Neurogenin2 during mouse postnatal retinal neurogenesis. Dev Biol 442:220-235 (2018). PubMed: 30048641
- Serjanov D et al. Laminin ß2 Chain Regulates Retinal Progenitor Cell Mitotic Spindle Orientation via Dystroglycan. J Neurosci 38:5996-6010 (2018). PubMed: 29853630
- Hor JH et al. Cell cycle inhibitors protect motor neurons in an organoid model of Spinal Muscular Atrophy. Cell Death Dis 9:1100 (2018). PubMed: 30368521
- Hughes S et al. Characterisation of light responses in the retina of mice lacking principle components of rod, cone and melanopsin phototransduction signalling pathways. Sci Rep 6:28086 (2016). PubMed: 27301998
- Kanda A et al. Atp6ap2/(pro)renin receptor interacts with Par3 as a cell polarity determinant required for laminar formation during retinal development in mice. J Neurosci 33:19341-51 (2013). Mouse . PubMed: 24305829
- Chang HH et al. Intravitreal homocysteine-thiolactone injection leads to the degeneration of multiple retinal cells, including photoreceptors. Mol Vis 17:1946-56 (2011). IHC-P ; Mouse . PubMed: 21850169
- Liu W et al. Neuroretina specification in mouse embryos requires Six3-mediated suppression of Wnt8b in the anterior neural plate. J Clin Invest 120:3568-77 (2010). IHC ; Mouse . PubMed: 20890044
- Shechter R et al. Toll-like receptor 4 restricts retinal progenitor cell proliferation. J Cell Biol 183:393-400 (2008). IHC-P ; Mouse . PubMed: 18981228