For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    chx10-antibody-ab16141.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Sensory System Visual system
Share by email

Anti-CHX10 antibody (ab16141)

  • Datasheet
Reviews (3)Q&A (1)References (10)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-CHX10 antibody (ab16141)

    Key features and details

    • Sheep polyclonal to CHX10
    • Suitable for: WB
    • Reacts with: Mouse, Rat
    • Isotype: IgG

    You may also be interested in

    Primary
    Product image
    Anti-Islet 1 antibody [EP4182] - Neural Stem Cell Marker (ab109517)
    Primary
    Product image
    Alexa Fluor® 647 Anti-PAX6 antibody [EPR3352(2)] (ab215925)
    Primary
    Product image
    Anti-FOXD3 antibody (ab64807)

    View more associated products

    Overview

    • Product name

      Anti-CHX10 antibody
      See all CHX10 primary antibodies
    • Description

      Sheep polyclonal to CHX10
    • Host species

      Sheep
    • Tested Applications & Species

      Application Species
      WB
      Mouse
      Rat
      See all applications and species data
    • Immunogen

      Recombinant fragment corresponding to Human CHX10 aa 264-361 (C terminal).
      Sequence:

      EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKA QEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA


      Database link: P58304
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

      Chx10 is a 46kDa homeodomain protein of the paired-like class that is essential for development of the mammalian eye. Mutations in Chx10 cause microphthalmia, a cause of congenital blindness in humans, and the ocular retardation (or) phenotype in mice. In the developing mouse retina Chx10 is expressed in retinal progenitors, while in the mature retina, Chx10 expression becomes restricted to bipolar neurons. Concurrent with these expression patterns, the Chx10-/- (or) retina is thin due to a defect in proliferation of retinal progenitors, and lacks bipolar neurons. Chx10 is also expressed in the developing brainstem, thalamus, and spinal cord.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
    • Storage buffer

      Preservative: 0.08% Sodium azide
      Constituent: PBS
    • Concentration information loading...
    • Purity

      Ammonium Sulphate Precipitation
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Neuroscience
      • Sensory System
      • Visual system
      • Neuroscience
      • Neurology process
      • Neurogenesis

    Associated products

    • ChIP Related Products

      • ChIP Kit (ab500)
    • Isotype control

      • Sheep IgG - Isotype Control (ab37385)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab16141 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    WB
    Mouse
    Rat
    Application Abreviews Notes
    WB
    Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.
    Notes
    WB
    Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.

    Target

    • Function

      Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells.
    • Tissue specificity

      Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate.
    • Involvement in disease

      Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2) [MIM:610093]; also known as isolated clinical anophthalmia. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present.
      Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092].
      Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3) [MIM:610092]; also known as isolated colobomatous microphthalmia 3. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure).
    • Sequence similarities

      Belongs to the paired homeobox family.
      Contains 1 CVC domain.
      Contains 1 homeobox DNA-binding domain.
    • Cellular localization

      Nucleus.
    • Target information above from: UniProt accession P58304 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 12677 Mouse
      • Entrez Gene: 171360 Rat
      • SwissProt: Q61412 Mouse
      • Unigene: 4405 Mouse
      • Unigene: 92414 Rat
      • Alternative names

        • C elegans ceh 10 homeo domain containing homolog antibody
        • Ceh 10 homeo domain containing homolog (C. elegans) antibody
        • Ceh 10 homeo domain containing homolog antibody
        • Ceh 10 homeodomain containing homolog antibody
        • Ceh 10 homeodomain containing homolog (C. elegans) antibody
        • Ceh-10 homeodomain-containing homolog antibody
        • Ceh10 homeo domain containing homolog antibody
        • Ceh10 homeodomain containing homolog antibody
        • CHX 10 antibody
        • Homeobox protein CHX 10 antibody
        • Homeobox protein CHX10 antibody
        • HOX 10 antibody
        • HOX10 antibody
        • MCOP 2 antibody
        • MCOP2 antibody
        • MCOPCB 3 antibody
        • MCOPCB3 antibody
        • RET 1 antibody
        • RET1 antibody
        • Visual system homeobox 2 antibody
        • Vsx 2 antibody
        • Vsx2 antibody
        • VSX2_HUMAN antibody
        see all

      Images

      • Western blot - Anti-CHX10 antibody (ab16141)
        Western blot - Anti-CHX10 antibody (ab16141)

        Western blot analysis using ab16141 at 1 µg/ml on rat liver (A), rat retina tissue lysate (B), mouse liver (C) and mouse retina tissue lysate (D).

      Protocols

      • ChIP protocols
      • Western blot protocols
      • Immunohistochemistry protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (10)

      Publishing research using ab16141? Please let us know so that we can cite the reference in this datasheet.

      ab16141 has been referenced in 10 publications.

      • Kumamaru H  et al. Regenerating Corticospinal Axons Innervate Phenotypically Appropriate Neurons within Neural Stem Cell Grafts. Cell Rep 26:2329-2339.e4 (2019). PubMed: 30811984
      • Chaimowicz C  et al. Teashirt 1 (Tshz1) is essential for the development, survival and function of hypoglossal and phrenic motor neurons in mouse. Development 146:N/A (2019). PubMed: 31427287
      • Kowalchuk AM  et al. Requirements for Neurogenin2 during mouse postnatal retinal neurogenesis. Dev Biol 442:220-235 (2018). PubMed: 30048641
      • Serjanov D  et al. Laminin ß2 Chain Regulates Retinal Progenitor Cell Mitotic Spindle Orientation via Dystroglycan. J Neurosci 38:5996-6010 (2018). PubMed: 29853630
      • Hor JH  et al. Cell cycle inhibitors protect motor neurons in an organoid model of Spinal Muscular Atrophy. Cell Death Dis 9:1100 (2018). PubMed: 30368521
      • Hughes S  et al. Characterisation of light responses in the retina of mice lacking principle components of rod, cone and melanopsin phototransduction signalling pathways. Sci Rep 6:28086 (2016). PubMed: 27301998
      • Kanda A  et al. Atp6ap2/(pro)renin receptor interacts with Par3 as a cell polarity determinant required for laminar formation during retinal development in mice. J Neurosci 33:19341-51 (2013). Mouse . PubMed: 24305829
      • Chang HH  et al. Intravitreal homocysteine-thiolactone injection leads to the degeneration of multiple retinal cells, including photoreceptors. Mol Vis 17:1946-56 (2011). IHC-P ; Mouse . PubMed: 21850169
      • Liu W  et al. Neuroretina specification in mouse embryos requires Six3-mediated suppression of Wnt8b in the anterior neural plate. J Clin Invest 120:3568-77 (2010). IHC ; Mouse . PubMed: 20890044
      • Shechter R  et al. Toll-like receptor 4 restricts retinal progenitor cell proliferation. J Cell Biol 183:393-400 (2008). IHC-P ; Mouse . PubMed: 18981228

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      1-4 of 4 Abreviews or Q&A

      Immunohistochemistry (Frozen sections) abreview for Anti-CHX10 antibody

      Average
      Abreviews
      Abreviews
      abreview image
      Application
      Immunohistochemistry (Frozen sections)
      Sample
      Mouse Tissue sections (Differentiated mESCs)
      Permeabilization
      Yes - PBT
      Specification
      Differentiated mESCs
      Blocking step
      BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 25°C
      Fixative
      Paraformaldehyde
      Read More

      Miss. Ieva Berzanskyte

      Verified customer

      Submitted Apr 17 2018

      Immunohistochemistry (Frozen sections) abreview for Anti-CHX10 antibody

      Excellent
      Abreviews
      Abreviews
      abreview image
      Application
      Immunohistochemistry (Frozen sections)
      Sample
      Human Tissue sections (Pluripotent stem cell-derived retinal organoid)
      Permeabilization
      Yes - 0.3% Triton X-100
      Specification
      Pluripotent stem cell-derived retinal organoid
      Blocking step
      Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 21°C
      Fixative
      Paraformaldehyde
      Read More

      Abcam user community

      Verified customer

      Submitted Apr 12 2017

      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-CHX10 antibody

      Excellent
      Abreviews
      Abreviews
      abreview image
      Application
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
      Sample
      Mouse Tissue sections (E12.5 mouse spinal cord)
      Antigen retrieval step
      Heat mediated - Buffer/Enzyme Used: 0.01M sodium-citrate buffer pH 6.0
      Permeabilization
      Yes - 0.1% Triton-X 100
      Specification
      E12.5 mouse spinal cord
      Blocking step
      10% donkey serum + 1% BSA in PBS with 0.1% Triton X-100 as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
      Fixative
      Paraformaldehyde
      Read More

      Abcam user community

      Verified customer

      Submitted Aug 06 2013

      Question

      Testing discount information for ab16141 to test in IHC-Fr

      Read More

      Abcam community

      Verified customer

      Asked on May 17 2012

      Answer

      Thank you very much for your interest in ab16141.

      To our knowledge, ab16141 has not been tested in IHC-Fr. Therefore, I can offer a discount off a future purchase if you buy ab16141 now, test it inIHC-Fr and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free PRIMARY ANTIBODY.

      If you are interested in this offer, please follow these steps:

      1. Reply to this e-mail to let me know that you would like to proceed and test ab16141 in IHC-Fr. I will then send a discount code. This code must be issued before purchasing ab16141 so please wait for my reply before ordering.

      2. Purchase ab16141 either by phone, fax, or online (www.abcam.com).

      3. Test it in IHC-Fr.

      4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

      5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY /PROTEIN ordered and the discount code is valid for 4 months after issue.

      We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab16141 turns out to be unsuitable for IHC-Fr, you will still receive the discount on your next purchase after your Abreview has been submitted.

      Please let me know if you have any questions about this offer and I would be happy to help you further.

      The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

      Read More

      Abcam Scientific Support

      Answered on May 17 2012

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.