Overview

  • Product name
  • Description
    Sheep polyclonal to CHX10
  • Host species
    Sheep
  • Tested applications
    Suitable for: WB, ChIP, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Recombinant fragment:

    EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKA QEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA

    , corresponding to C terminal amino acids 264-361 of Human CHX10.

  • Positive control
    • Rat or mouse retinal tissue lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.08% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity
    Ammonium Sulphate Precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab16141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
ChIP
IHC-P
  • Application notes
    ChIP: Use at an assay dependent dilution (PMID 14272592).
    IHC-P: 1/200 (PMID 18981228).
    WB: Use at a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells.
    • Tissue specificity
      Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate.
    • Involvement in disease
      Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2) [MIM:610093]; also known as isolated clinical anophthalmia. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present.
      Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092].
      Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3) [MIM:610092]; also known as isolated colobomatous microphthalmia 3. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure).
    • Sequence similarities
      Belongs to the paired homeobox family.
      Contains 1 CVC domain.
      Contains 1 homeobox DNA-binding domain.
    • Cellular localization
      Nucleus.
    • Information by UniProt
    • Database links
    • Alternative names
      • C elegans ceh 10 homeo domain containing homolog antibody
      • Ceh 10 homeo domain containing homolog (C. elegans) antibody
      • Ceh 10 homeo domain containing homolog antibody
      • Ceh 10 homeodomain containing homolog antibody
      • Ceh 10 homeodomain containing homolog (C. elegans) antibody
      • Ceh-10 homeodomain-containing homolog antibody
      • Ceh10 homeo domain containing homolog antibody
      • Ceh10 homeodomain containing homolog antibody
      • CHX 10 antibody
      • Homeobox protein CHX 10 antibody
      • Homeobox protein CHX10 antibody
      • HOX 10 antibody
      • HOX10 antibody
      • MCOP 2 antibody
      • MCOP2 antibody
      • MCOPCB 3 antibody
      • MCOPCB3 antibody
      • RET 1 antibody
      • RET1 antibody
      • Visual system homeobox 2 antibody
      • Vsx 2 antibody
      • Vsx2 antibody
      • VSX2_HUMAN antibody
      see all

    Images

    • ab16141 staining CHX10 in Mouse E12.5 spinal cord tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with paraformaldehyde and blocked with 10% donkey serum + 1% BSA in PBS with 0.1% Triton X-100 for 1 hour at room temperature; antigen retrieval was by heat mediation in a 0.01M sodium-citrate buffer. Samples were incubated with primary antibody (1/500 in 1% BSA in PBS with 0.1% Trition X-100) for 16 hours. An Alexa Fluor® 488-conjugated Donkey anti-sheep IgG polyclonal (1/400) was used as the secondary antibody.

      See Abreview

    • Western blot analysis using ab16141 at 1 µg/ml on rat liver (A), rat retina tissue lysate (B), mouse liver (C) and mouse retina tissue lysate (D).

      Western blot analysis using ab16141 at 1 µg/ml on rat liver (A), rat retina tissue lysate (B), mouse liver (C) and mouse retina tissue lysate (D).

    References

    This product has been referenced in:
    • Kowalchuk AM  et al. Requirements for Neurogenin2 during mouse postnatal retinal neurogenesis. Dev Biol 442:220-235 (2018). Read more (PubMed: 30048641) »
    • Hughes S  et al. Characterisation of light responses in the retina of mice lacking principle components of rod, cone and melanopsin phototransduction signalling pathways. Sci Rep 6:28086 (2016). Read more (PubMed: 27301998) »
    See all 6 Publications for this product

    Customer reviews and Q&As

    1-4 of 4 Abreviews or Q&A

    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Mouse Tissue sections (Differentiated mESCs)
    Permeabilization
    Yes - PBT
    Specification
    Differentiated mESCs
    Blocking step
    BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 25°C
    Fixative
    Paraformaldehyde

    Miss. Ieva Berzanskyte

    Verified customer

    Submitted Apr 17 2018

    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Human Tissue sections (Pluripotent stem cell-derived retinal organoid)
    Permeabilization
    Yes - 0.3% Triton X-100
    Specification
    Pluripotent stem cell-derived retinal organoid
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 21°C
    Fixative
    Paraformaldehyde

    Abcam user community

    Verified customer

    Submitted Apr 12 2017

    Abcam guarantees this product to work in the species/application used in this Abreview.
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Mouse Tissue sections (E12.5 mouse spinal cord)
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: 0.01M sodium-citrate buffer pH 6.0
    Permeabilization
    Yes - 0.1% Triton-X 100
    Specification
    E12.5 mouse spinal cord
    Blocking step
    10% donkey serum + 1% BSA in PBS with 0.1% Triton X-100 as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
    Fixative
    Paraformaldehyde

    Abcam user community

    Verified customer

    Submitted Aug 06 2013

    Question
    Answer

    Thank you very much for your interest in ab16141.

    To our knowledge, ab16141 has not been tested in IHC-Fr. Therefore, I can offer a discount off a future purchase if you buy ab16141 now, test it inIHC-Fr and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free PRIMARY ANTIBODY.

    If you are interested in this offer, please follow these steps:

    1. Reply to this e-mail to let me know that you would like to proceed and test ab16141 in IHC-Fr. I will then send a discount code. This code must be issued before purchasing ab16141 so please wait for my reply before ordering.

    2. Purchase ab16141 either by phone, fax, or online (www.abcam.com).

    3. Test it in IHC-Fr.

    4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

    5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY /PROTEIN ordered and the discount code is valid for 4 months after issue.

    We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab16141 turns out to be unsuitable for IHC-Fr, you will still receive the discount on your next purchase after your Abreview has been submitted.

    Please let me know if you have any questions about this offer and I would be happy to help you further.

    The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up