Anti-CHX10 antibody (ab16141)
- Datasheet
- References (9)
- Protocols
Overview
-
Product name
Anti-CHX10 antibody
See all CHX10 primary antibodies -
Description
Sheep polyclonal to CHX10 -
Host species
Sheep -
Tested applications
Suitable for: WB, ChIP, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Cow, Human -
Immunogen
Recombinant fragment:
EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKA QEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
, corresponding to C terminal amino acids 264-361 of Human CHX10. -
Positive control
- Rat or mouse retinal tissue lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Ammonium Sulphate Precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
ChIP Related Products
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab16141 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | ||
| ChIP | ||
| IHC-P |
IHC-P: 1/200 (PMID 18981228).
WB: Use at a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 46 kDa.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Target
-
Function
Plays a significant role in the specification and morphogenesis of the sensory retina. May also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells. -
Tissue specificity
Abundantly expressed in retinal neuroblasts during eye development and in the inner nuclear layer of the adult retina. Within this layer, expression is stronger in the outer margin where bipolar cells predominate. -
Involvement in disease
Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2) [MIM:610093]; also known as isolated clinical anophthalmia. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present.
Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI) [MIM:610092].
Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3) [MIM:610092]; also known as isolated colobomatous microphthalmia 3. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure). -
Sequence similarities
Belongs to the paired homeobox family.
Contains 1 CVC domain.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 338917 Human
- Entrez Gene: 12677 Mouse
- Entrez Gene: 171360 Rat
- Omim: 142993 Human
- SwissProt: P58304 Human
- SwissProt: Q61412 Mouse
- Unigene: 449771 Human
- Unigene: 4405 Mouse
see all -
Alternative names
- C elegans ceh 10 homeo domain containing homolog antibody
- Ceh 10 homeo domain containing homolog (C. elegans) antibody
- Ceh 10 homeo domain containing homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CHX10 antibody (ab16141)This image is courtesy of an anonymous Abreviewab16141 staining CHX10 in Mouse E12.5 spinal cord tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with paraformaldehyde and blocked with 10% donkey serum + 1% BSA in PBS with 0.1% Triton X-100 for 1 hour at room temperature; antigen retrieval was by heat mediation in a 0.01M sodium-citrate buffer. Samples were incubated with primary antibody (1/500 in 1% BSA in PBS with 0.1% Trition X-100) for 16 hours. An Alexa Fluor® 488-conjugated Donkey anti-sheep IgG polyclonal (1/400) was used as the secondary antibody.
-
Western blot - Anti-CHX10 antibody (ab16141)Western blot analysis using ab16141 at 1
Western blot analysis using ab16141 at 1 µg/ml on rat liver (A), rat retina tissue lysate (B), mouse liver (C) and mouse retina tissue lysate (D).µ
Datasheets and documents
References
This product has been referenced in:
- Kumamaru H et al. Regenerating Corticospinal Axons Innervate Phenotypically Appropriate Neurons within Neural Stem Cell Grafts. Cell Rep 26:2329-2339.e4 (2019). Read more (PubMed: 30811984) »
- Kowalchuk AM et al. Requirements for Neurogenin2 during mouse postnatal retinal neurogenesis. Dev Biol 442:220-235 (2018). Read more (PubMed: 30048641) »
