Overview

  • Product name

    Anti-Chymotrypsin antibody
    See all Chymotrypsin primary antibodies
  • Description

    Rabbit polyclonal to Chymotrypsin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat Chymotrypsin aa 30-268. Mature chain lacking signal and propeptides. Expressed in E.coli. N-terminal tags.
    Sequence:

    VVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCINKD FTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAE PVELSNTIQVACIPEEGSLLPQDYPCYVTGWGRLWTNGPIAEVLQQGLQP IVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSW QVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINEKIQL


    Database link: P55091

  • Positive control

    • WB: Recombinant rat Chymotrypsin; rat pancreas and testis lysates; IHC-P: Rat pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Has chymotrypsin-type protease activity and hypocalcemic activity.
  • Tissue specificity

    Pancreas.
  • Involvement in disease

    Variations in CTRC influence susceptibility to chronic pancreatitis [MIM:167800]. Chronic pancreatitis is a persistent inflammatory disorder characterized by permanent destruction of the pancreatic parenchyma.
  • Sequence similarities

    Belongs to the peptidase S1 family. Elastase subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caldecrin antibody
    • Chymotrypsin C antibody
    • Chymotrypsin-C antibody
    • ChymotrypsinC antibody
    • CLCR antibody
    • Ctrc antibody
    • CTRC_HUMAN antibody
    • ELA 4 antibody
    • ELA4 antibody
    • Elastase 4 antibody
    • Elastase IV antibody
    • Elastase4 antibody
    • ElastaseIV antibody
    • OTTHUMP00000044526 antibody
    • Serum calcium decreasing factor antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for Chymotrypsin using ab231724 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Chymotrypsin antibody (ab231724) at 2 µg/ml + Rat pancreas lysate

    Predicted band size: 29 kDa

  • Anti-Chymotrypsin antibody (ab231724) at 2 µg/ml + Rat testis lysate

    Predicted band size: 29 kDa

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for Chymotrypsin using ab231724 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Chymotrypsin antibody (ab231724) at 2 µg/ml + Recombinant rat Chymotrypsin protein

    Predicted band size: 29 kDa

References

ab231724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up